(data stored in ACNUC1104 zone)

EMBL: FN667741.PE102

FN667741.PE102       Location/Qualifiers
FT   CDS_pept        complement(112701..113294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0021"
FT                   /locus_tag="XBJ1_0106"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0106"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79257"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY79"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79257.1"
FT                   /translation="MKVPYFSQWESFHLANDIIHHQLPLSHDPLWEQSGADSPEEYAKW
FT                   ANHICGMACLKMLLAARSGKIYPLLKLTKMATEYGAYQIEDEHIKGMIYAPVVSMLSEQ
FT                   FGIISQIVTGMTAEKIHEVFTQDSLYIASVHPSIRWPTRLPEKKGGHLVLVTNATPEEI
FT                   TFHNPSGANTQSQIDVKMSVDIFGRFYAERGILI"
     atgaaagtcc cctatttttc tcagtgggaa tcattccatt tagccaatga cattattcac        60
     catcaacttc cacttagtca tgatccgcta tgggaacaat ccggtgcaga ttccccagag       120
     gaatatgcaa aatgggcaaa tcatatttgt ggtatggctt gtcttaaaat gttgcttgca       180
     gctcgctcag ggaaaattta cccattgctg aaattaacta aaatggcaac cgagtacgga       240
     gcataccaga tagaagatga gcatataaaa ggaatgattt atgctcctgt agtttcaatg       300
     ttatcggaac aatttgggat tatctctcaa atagtgaccg gtatgacggc cgaaaagata       360
     catgaagttt ttacccaaga tagtttatat atagcttccg ttcatcctag tatcagatgg       420
     ccaacacgat tacctgaaaa aaagggcgga catcttgtac tggtgactaa cgctacaccc       480
     gaagaaataa cttttcataa tccttctggt gctaacactc aaagtcaaat tgatgtaaaa       540
     atgtcagtag atatttttgg ccgattttat gccgagcgtg gcatactcat ttag             594
//

If you have problems or comments...

PBIL Back to PBIL home page