(data stored in ACNUC1104 zone)

EMBL: FN667741.PE103

FN667741.PE103       Location/Qualifiers
FT   CDS_pept        complement(113291..113896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0021"
FT                   /locus_tag="XBJ1_0107"
FT                   /product="hypothetical protein; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0107"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79258"
FT                   /db_xref="GOA:D3UY80"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY80"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79258.1"
FT                   /translation="MLIAQQNLINKSLSSATYVFPISLGFIALIDILIFGSNLTFSSIL
FT                   SINILFVAGILFTMIGHIKSMHKRSKLMFFIMIFCVIGFAIMDRTGIPMSGWFTYLLFT
FT                   GVGNISVIFFYQKNKFSFVPLKFWLSISIIWFLPELFFNYAIATYLPVSYGYLAITLRI
FT                   PLLMLISVLVYREGKLSEQMLFSFVAVIAILLMFMERL"
     atgctgatag cacaacaaaa tcttatcaac aaaagccttt catctgccac ttatgtattc        60
     cctatatctc ttgggtttat tgcactcatt gatatactga tatttggttc taatcttacc       120
     ttttcctcaa tcctcagtat taacattctt tttgtcgccg gaattctttt cactatgatt       180
     ggtcatatta aaagcatgca caaacgaagt aagcttatgt ttttcattat gatattctgt       240
     gtaatcgggt ttgcaattat ggaccgaaca gggattccca tgagtggttg gtttacctat       300
     ttattattta ctggcgtagg gaatatatct gttatttttt tctatcagaa aaataaattt       360
     tcttttgttc cactgaaatt ttggctttcc atatcaatca tctggttttt accagaatta       420
     ttttttaact atgctattgc cacttattta cctgtcagct acggatatct agcaataact       480
     ctcagaattc ctttacttat gctaatttca gtgcttgtct atcgtgaagg aaaactctct       540
     gaacaaatgt tattttcctt tgttgctgtt atcgcaattt tacttatgtt catggagaga       600
     ctatga                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page