(data stored in ACNUC1104 zone)

EMBL: FN667741.PE110

FN667741.PE110       Location/Qualifiers
FT   CDS_pept        117745..118257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0023"
FT                   /locus_tag="XBJ1_0114"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0114"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79265"
FT                   /db_xref="GOA:D3UY87"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY87"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79265.1"
FT                   /translation="MKIECLNKNKHDRNNFDCGEPALNNYLKAVSGQHDKKDLSRTFVL
FT                   TSSQNESQIKGYYSLALCTVELDEIPEKISKKYPSSLYCALIGRLAINKLFQRQGLGEI
FT                   LLIDAIRKSIESSESIPTPMIIVDAKHDIAKKFYINMGFQEFPKMKFRLFMPMNAAVNI
FT                   IEQIDAI"
     atgaagatcg agtgtctaaa taaaaataaa cacgatagaa ataattttga ctgtggtgaa        60
     cctgcgttaa acaactattt gaaagcagta tcagggcagc atgataaaaa ggacctatca       120
     aggacatttg tcctgacaag tagtcagaat gaatctcaaa taaaggggta ttattcacta       180
     gcgctgtgca cggtagaact agacgaaata ccagaaaaaa tatcgaaaaa atacccttcc       240
     agtttgtatt gcgcacttat tggccgatta gctataaata aattatttca acgccaagga       300
     cttggcgaaa ttttgttgat agatgcaatt cgaaaatcaa tagaatcgtc agaatccatt       360
     cctactccaa tgattatcgt tgacgctaag cacgatattg ctaaaaaatt ctatataaac       420
     atggggtttc aggaatttcc aaaaatgaaa ttcaggctct ttatgcctat gaatgcagct       480
     gtgaacatta tagagcaaat cgacgcgata taa                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page