(data stored in ACNUC1104 zone)

EMBL: FN667741.PE129

FN667741.PE129       Location/Qualifiers
FT   CDS_pept        complement(135891..136979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0026"
FT                   /locus_tag="XBJ1_0133"
FT                   /product="putative phosphotriesterase with
FT                   metallo-dependent hydrolase domain (modular protein)"
FT                   /EC_number="3.1.8.1"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0133"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79284"
FT                   /db_xref="GOA:D3UYA6"
FT                   /db_xref="InterPro:IPR001559"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYA6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79284.1"
FT                   /translation="MGYQKQTGNTPTHSATYSSSRIDEAEDALKQADYQEYQVKRRGET
FT                   LLYSSNKQLNNPHLGTQQNTCIDTSGYTYVHEHLHIDLSGAKGSLDCRLDQYDLIVDEL
FT                   RHLYTLGLRNIAEMTNRYMGRNANFLLDLMRDSHINIIASTGYYKEPFFPAHFSELSVQ
FT                   AIADDMIAEIETGIDGTGLKAGVIAEIGSSLDQITADEKKVFAAAALAHHATGCPISTH
FT                   TTLSTMGREQLALLKEFGVSAEHVAIGHCDLKDNLDTIIPLLEEGAWIQFDTIGKNNYY
FT                   PDSGRIAMLREVAKRGLLGQVMLSQDITRRSHLKSNGGIGFDYLLTVFVPMLLAAGFSQ
FT                   TQIDLMLRDNPAQFFRHGFSKT"
     atgggatacc agaaacaaac tgggaatacg cccacacatt ccgctacgta ttcctcatcc        60
     agaattgatg aagctgaaga cgcactcaaa caggcggact accaagaata tcaggttaaa       120
     cgtcggggtg agacgctgct atattcatca aacaaacaat taaataaccc acatctgggt       180
     acacagcaaa atacctgtat tgatacatcg ggctatacct atgtgcatga acacctgcat       240
     atcgatctct ctggtgcgaa aggcagtctc gactgtcgat tagaccaata tgatctgatc       300
     gtcgatgaac ttcgtcacct ttataccctt ggcctacgga acatcgcgga gatgaccaac       360
     cgctacatgg ggcgcaatgc taacttccta ctggatttga tgcgtgatag ccacatcaac       420
     atcattgctt cgacgggtta ctataaagaa ccatttttcc ccgctcattt cagcgaattg       480
     agtgtacagg cgattgccga cgatatgatt gctgaaattg aaacgggcat tgacggtact       540
     gggctaaaag ccggcgtgat agcagaaatt ggttccagcc ttgatcaaat cacagcggat       600
     gagaagaaag tatttgccgc cgccgctctg gcacatcatg ccactggctg ccctatctcc       660
     acccatacca ccttaagcac aatgggacgt gagcaactgg ctctgctcaa agaatttggc       720
     gtttccgctg aacatgtggc tatcggtcat tgtgatctga aagataatct cgacacaatt       780
     attcccctgc ttgaagaagg ggcgtggata caattcgata cgattggcaa aaacaactac       840
     tatccagaca gtgggcgcat tgccatgttg cgggaagtcg ccaaacgtgg tctgctgggc       900
     caagtgatgc tatcccagga tatcactcgc cgttctcatt taaaaagtaa cgggggaatt       960
     ggattcgatt acctgttgac cgtattcgtg ccgatgttac tggcagctgg tttctcccaa      1020
     acgcagatag atctcatgtt acgcgataat cctgcacaat ttttccgaca cggcttttct      1080
     aagacttaa                                                              1089
//

If you have problems or comments...

PBIL Back to PBIL home page