(data stored in ACNUC1104 zone)

EMBL: FN667741.PE130

FN667741.PE130       Location/Qualifiers
FT   CDS_pept        complement(137076..138251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0134"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0134"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79285"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYA7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79285.1"
FT                   /translation="MFINALKKQNPKLIEIAKDLWQQGAILPDTYIIDVDQVLDNGRHL
FT                   LQAAEQYGIELYLMTKQIGRNPWLAQKLIELGYPGVVAVDFREAYALSQHGIPLCHIGH
FT                   LVQTPAHLIETMLKQHPGIITVFSIEKAQAISDAAEKLGRIQPIMLKVFDKRDITLPSQ
FT                   EAGIFFDELDTTVDVLKTMPGIKLSGLTHFPCLEWNARYQTTLPTINLQTLLRARNRLE
FT                   QLGIELSQINAPSASSCNTIPLLAKYGATHLEPGHALTGTIPANISGQEPEKISMVYIT
FT                   EVSHHYDGNSYCYGGGYYKRGHMKYALVFPEHARSPKTVRVLSLGDPCIDYHIPISGIH
FT                   PIGSPVIMCFRTQIFVTRSDVALVSGIQSGSPKLQGIYDSQGNWKNRGYFQ"
     atgtttatca atgccctgaa aaaacagaac cccaaattga ttgaaatagc aaaagacctt        60
     tggcagcaag gcgcgatatt accagacact tacatcattg atgtcgatca ggtcttggac       120
     aatggtcggc atttactgca agcagcagag caatatggca ttgaactcta tttgatgacc       180
     aaacagattg gccgtaatcc ctggctggct caaaagctca ttgaactcgg ttaccctggt       240
     gtcgtggccg tggatttcag ggaggcatat gccctgagtc agcatggcat accgctatgc       300
     cacatcggtc atttggtaca aacccctgca cacctgatag aaaccatgct taaacagcat       360
     ccgggtatca ttacggtgtt ttccattgaa aaagcacagg cgatctcaga tgccgcagag       420
     aaattgggac ggattcagcc catcatgctg aaagtgtttg ataagcgtga tatcacttta       480
     ccctctcagg aagcaggtat cttcttcgat gaactggata caaccgttga cgtattaaaa       540
     accatgccgg gcattaagtt gagcggttta acccatttcc cctgcctgga gtggaacgcc       600
     cgatatcaga caaccctgcc caccatcaac ttgcagaccc tcctcagggc gcgcaacaga       660
     cttgaacagc ttggcattga actctcacaa atcaatgcgc cttcagcatc aagctgcaac       720
     accatccccc tgctggcaaa atacggtgct acccaccttg agccgggaca tgccctgacc       780
     ggcacgatac ccgccaatat cagtggccaa gaacctgaaa agatctcaat ggtttatatc       840
     accgaggttt cccatcacta cgacggcaac agttactgct atggcggcgg ctactataaa       900
     cgtggacata tgaaatacgc gctggttttc cctgaacatg cgcgctcccc caaaaccgtg       960
     cgggtactga gtctgggaga tccctgcatt gattaccata tcccgatatc cggtatccat      1020
     cctatcggca gcccagtgat catgtgcttc cgtacccaga tttttgtcac ccgcagcgac      1080
     gtagctctcg tttccggcat tcaatccggt tcaccaaagc ttcaaggcat ttatgacagt      1140
     caaggaaatt ggaaaaacag gggttatttt caataa                                1176
//

If you have problems or comments...

PBIL Back to PBIL home page