(data stored in ACNUC1104 zone)

EMBL: FN667741.PE131

FN667741.PE131       Location/Qualifiers
FT   CDS_pept        complement(138356..138718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0027"
FT                   /locus_tag="XBJ1_0135"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0135"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79286"
FT                   /db_xref="GOA:D3UYA8"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYA8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79286.1"
FT                   /translation="MVEQRLTILLQGGVIDQDIYDNMLDIVHDLEDIWLIPVHHPQGEM
FT                   ALTHMASAFMRSRRGEIVLPLEKNILTKIEQSEHCAQLFKIHRALLEKFTITLHPNEEG
FT                   YLLVNLYGLILATKIP"
     atggtagaac aacgactaac tatcctgttg caaggtggcg tcatcgacca agatatctac        60
     gataacatgc ttgatattgt gcatgatcta gaagatatct ggttaatccc tgtccatcat       120
     ccacaaggtg aaatggcgct tacccacatg gcgagtgctt tcatgcgctc acgtcgcggc       180
     gaaattgttt tgccacttga aaagaatatc ttgaccaaaa tcgagcagtc agaacactgc       240
     gcacaattat tcaaaatcca tcgcgcattg ttagaaaaat tcacaatcac actgcacccc       300
     aacgaagaag gctatctgtt ggtaaattta tatggtttaa tactggcaac caaaattccc       360
     tga                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page