(data stored in ACNUC1104 zone)

EMBL: FN667741.PE132

FN667741.PE132       Location/Qualifiers
FT   CDS_pept        complement(138768..139676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0027"
FT                   /locus_tag="XBJ1_0136"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0136"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79287"
FT                   /db_xref="InterPro:IPR032791"
FT                   /db_xref="InterPro:IPR041444"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYA9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79287.1"
FT                   /translation="MMSQTFIKKEGIAQSFLARYLLSEQCGNRLKTIELLAKECGLSVG
FT                   LMQAALKSLEQAQAVGIKRRGRNGSFLSQINHKLLLEYADIGNVVCAMPLPYTRAYEGL
FT                   ASGLKALCAEIPFYFAHMRGSDIRIECLLNGVYDLAVTSRLAAEQHPENKDLYIALSLG
FT                   TQSYTDRHRLIFRHGEMDSIRRVGLDSTSADQKIMTNQYFEGKEIEVVEVSYHECLNQI
FT                   MKGHIDAAIWNVGQGHELVAQGLMTQLPDDSECFIKASEAVILARKDNIPIQQLLYTMV
FT                   DREALLTHQQNVVAGTIEPVY"
     atgatgagtc aaacattcat taaaaaagag gggattgcac aatcgtttct agctcgttat        60
     ctcctctctg agcaatgtgg caaccgcctg aaaactatcg agttactggc taaagaatgt       120
     ggattgtccg taggtttaat gcaagcagca ttgaaatctc ttgaacaggc acaagcggtt       180
     ggaattaagc gtcgtggtcg taatggcagc tttctttcgc agattaacca taaattactc       240
     ttggagtatg ccgatatcgg caatgtggtc tgcgcaatgc cgcttcctta tacccgcgcc       300
     tatgaaggtc tggccagtgg tttaaaagca ttgtgtgcag agattccttt ttattttgca       360
     catatgcgtg gttcagacat ccgcattgaa tgcttactga atggcgtcta tgacttagca       420
     gtaacgtcaa gacttgccgc agagcagcac ccagaaaata aagatttata tattgcgctt       480
     tcactaggga cacaaagtta tacagacagg catagattaa tctttcgtca tggcgaaatg       540
     gattccattc gccgggttgg gttggacagt acttcagcag accaaaaaat aatgacgaat       600
     cagtattttg aaggaaaaga gattgaagtg gtcgaggtct cctatcacga atgtctgaat       660
     caaatcatga aaggccacat tgatgcggcc atttggaacg tcgggcaggg tcacgaactg       720
     gtagcacaag gtttgatgac tcagcttcca gatgatagtg agtgctttat caaagcctcc       780
     gaagccgtta ttttggctcg taaggacaac atccccatcc agcaactcct gtacaccatg       840
     gttgatcggg aagcactgct gactcatcaa caaaacgtgg tcgcaggcac aatcgagcca       900
     gtttattga                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page