(data stored in ACNUC1104 zone)

EMBL: FN667741.PE142

FN667741.PE142       Location/Qualifiers
FT   CDS_pept        complement(147058..147501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0146"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0146"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79297"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYB9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79297.1"
FT                   /translation="MPKELFTAEIESSGHLKMQCSTRGFSFHVDEPKNLGGTDEAMNPV
FT                   EALLSAFGACQCIVAKSFARKHKINLIDIQVKMEGELDTDGFTGRNKNTKMGFSKITSK
FT                   FYIKADNTEQEIRDFIDFVESNCPVLDTILNAPEIVTEVYPSR"
     atgcctaaag agttatttac tgctgaaata gaatcatccg gtcacctcaa aatgcaatgt        60
     tcaacacgtg gcttttcctt ccatgtggat gaacccaaaa atctgggagg aactgatgaa       120
     gccatgaatc ctgtggaagc attactttca gctttcggtg cctgccaatg tattgtggcg       180
     aaaagttttg cccgcaaaca taaaatcaac ttgattgata ttcaggtaaa aatggaaggg       240
     gaattggata ccgacggctt cacaggaaga aataaaaaca ccaaaatggg gttttccaaa       300
     atcacctcca aattctatat caaagccgat aataccgaac aagagatccg cgattttatt       360
     gattttgtcg aaagcaactg ccctgttctt gataccatcc tcaatgcacc tgaaattgtc       420
     actgaagttt atccttccag ataa                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page