(data stored in ACNUC1104 zone)

EMBL: FN667741.PE145

FN667741.PE145       Location/Qualifiers
FT   CDS_pept        148082..148471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0030"
FT                   /locus_tag="XBJ1_0149"
FT                   /product="Insertion element iso-IS1n protein insB"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0149"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79300"
FT                   /db_xref="GOA:D3UYC2"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYC2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79300.1"
FT                   /translation="MDEQWFFIGNKKQRHWLWYAFDTKRKQVIAHVFDPRTDATCRKLL
FT                   NLLVPFNIRFITTDNGGSYAREVVPEKHRVGKIFTQRIERHNLNLRIHIKRLARRTICY
FT                   SRSMEIHEKLIGAYIEKHHYNPLES"
     ttggatgagc agtggttttt tataggcaat aaaaaacaac gtcattggct ttggtatgct        60
     tttgatacga aaaggaaaca agtcatcgcc catgtctttg acccccgaac ggatgcaacc       120
     tgccgaaaat tgctcaactt attggtgcct tttaatattc gtttcatcac gaccgataac       180
     gggggaagtt atgccagaga agtggtgccg gaaaaacata gggtaggcaa aatttttacc       240
     caacgtatag agcggcataa tctcaatctg cgaattcata tcaaaaggtt ggcaagaaga       300
     accatttgtt actcacgttc aatggaaatc cacgaaaaac tcattggcgc atatattgaa       360
     aaacatcatt acaacccttt ggagtcatga                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page