(data stored in ACNUC1104 zone)

EMBL: FN667741.PE148

FN667741.PE148       Location/Qualifiers
FT   CDS_pept        150812..151540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0032"
FT                   /locus_tag="XBJ1_0152"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0152"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79303"
FT                   /db_xref="GOA:D3UYC5"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYC5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79303.1"
FT                   /translation="MNIRNRTPNFDDVANIVKILGITSNNGESFDRDLHLYSLIEKPWG
FT                   FEYRVYCDSIFDVWKLHISPQEKTSMHCHIQKDTVLICLNGSGVTKFLDGDEFNISVGQ
FT                   VVYIERGVFHQTISTGNDYLELIEVENPRNKFDLLRLSDDYGRAAQSYENVSLNHDLLS
FT                   PLKLISPGAYIRNVDINSKFSFFLEKLNIDILDDENILFIVSLSIDSHLSGKINIFLKE
FT                   DVKCRSYIGQQVLLISRKNK"
     atgaatattc gtaatagaac accgaatttt gatgacgtag ctaacattgt gaaaattcta        60
     gggataacat ctaataatgg tgaatctttt gatagagatt tgcatcttta ttcactaata       120
     gaaaaaccat gggggtttga atatcgggtt tattgtgatt caatttttga tgtatggaaa       180
     ttacatatat ctccacagga aaaaacctct atgcattgcc atattcaaaa agatactgtt       240
     ctcatctgct taaatggtag tggtgtgaca aaattccttg atggtgatga gtttaatata       300
     tctgttggcc aagtggttta tatagagcga ggagttttcc accaaactat ttcgactgga       360
     aatgattacc ttgaacttat tgaggtagaa aatccaagaa ataaattcga cctattacgt       420
     ttgtcagatg attatggtcg agcggctcaa tcatatgaaa atgttagtct taatcatgac       480
     ctgctttctc cactaaaatt aatctcacca ggagcatata ttcgaaatgt tgacataaac       540
     tctaaatttt cttttttcct tgaaaaatta aatattgata tattagatga tgaaaatatt       600
     ttatttattg tcagtcttag tattgatagt catctttcag gaaaaataaa tatcttttta       660
     aaagaagatg ttaaatgtcg tagctatatt ggccaacaag tcttactaat atcacgaaaa       720
     aataaataa                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page