(data stored in ACNUC1104 zone)

EMBL: FN667741.PE165

FN667741.PE165       Location/Qualifiers
FT   CDS_pept        162882..163040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0035"
FT                   /locus_tag="XBJ1_0169"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0169"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79320"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYE2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79320.1"
FT                   /translation="MVNSSVKSEGKLAVMMIFCFQLLSVTQTDMIKMRVSDGRELVLKF
FT                   EENKVNH"
     atggttaata gttcagtgaa atctgaggga aaactagctg taatgatgat attctgtttt        60
     caattattgt cagtaactca aactgatatg attaaaatgc gtgtttcgga tggtagagag       120
     ttggtattaa aatttgaaga aaacaaagtt aatcattga                              159
//

If you have problems or comments...

PBIL Back to PBIL home page