(data stored in ACNUC1104 zone)

EMBL: FN667741.PE166

FN667741.PE166       Location/Qualifiers
FT   CDS_pept        163053..163823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0035"
FT                   /locus_tag="XBJ1_0170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0170"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79321"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYE3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79321.1"
FT                   /translation="MEFDSNSHENAIQEAQRILKEAQTDLALRLEKAVEGVREVAQETM
FT                   HTIGQGGQRALWRTSYFFDSYEDVYQRINREDARVFLAAWSVARGGLFENNVIKKIVDI
FT                   YIDKLLEPHERDQAFLNELYEKLVRSSTIMMHLVAKFKTSGLAKNAVVSAITEAIYVAV
FT                   IKKAFIREGFKKFGMSITLAFQFYGYFDKAAVSASKLKRECPVLYWSFYANEIEMLYFI
FT                   FEPLFKHGISTIKKGKGSNVDDVYLAIMEIVGYN"
     atggaattcg atagtaacag ccatgaaaat gccatacagg aagcgcaaag gattttaaaa        60
     gaagctcaaa ctgatcttgc tttaagattg gaaaaggcgg ttgaaggtgt aagggaagtt       120
     gcacaggaaa caatgcatac cataggacaa ggagggcaga gagctttatg gagaacttca       180
     tatttttttg acagttatga agatgtatat caaagaataa atagagaaga tgcaagggta       240
     tttctcgcgg cttggtcggt agctagagga ggtttatttg aaaataatgt tataaaaaaa       300
     attgttgata tttacataga taaattatta gagcctcatg agcgtgatca ggctttttta       360
     aatgaacttt atgaaaaatt agttcgttcg tctacaatca tgatgcattt agtcgctaaa       420
     tttaagacat caggtttggc aaagaatgct gttgtttctg ccataacaga agctatctat       480
     gtagcagtaa ttaaaaaagc atttattagg gaaggcttta agaagtttgg aatgtctatc       540
     actttagcat ttcaatttta tggttatttt gataaggctg ctgtatctgc gagtaagtta       600
     aaaagagaat gtcctgtttt atactggtct ttttatgcta atgagataga gatgttgtat       660
     tttatttttg aacctttatt taaacatggc atttctacaa taaaaaaagg aaaagggagt       720
     aatgtagatg atgtttattt agctataatg gaaatcgttg gttataactg a                771
//

If you have problems or comments...

PBIL Back to PBIL home page