(data stored in ACNUC1104 zone)

EMBL: FN667741.PE171

FN667741.PE171       Location/Qualifiers
FT   CDS_pept        complement(165515..166297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0036"
FT                   /locus_tag="XBJ1_0175"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0175"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79326"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYE8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79326.1"
FT                   /translation="MKFLCNKRVLSPLLAVFFIQGCAQSGSFSPPINGENVHFMATIPD
FT                   ELDALPISAMYRSKICRKERRTANMKSYSVPGFHHATYPLSIGQSNQVEVSVPKEGGGK
FT                   CDWKLSNLTFEVKLKDTSTIAPLIDDNFGFKTTFVIDGNAPQEFDGGYIKKTGNLNEEI
FT                   TLFPLLRERFLGGHSQSFYLVGEHDVMTYKMDNGRKIHLNVLYEKKFLTHWNGGKNKDA
FT                   DTSMTYPDGTIIYNGDVIPDFDKLMRILESRNSKQTKM"
     atgaaatttc tctgtaataa acgcgtatta tcccccctgc ttgctgtgtt tttcatacaa        60
     ggatgtgcgc aaagcggatc attctctcca ccgattaatg gagagaatgt tcattttatg       120
     gccactattc cggatgagtt ggatgcctta cccatttcag ccatgtatcg ttctaaaatt       180
     tgccgcaaag aacgccgaac tgcgaatatg aaatcgtatt ctgttccggg ttttcatcat       240
     gctacctacc cgctatcaat cggtcagtca aatcaagttg aggtcagtgt ccctaaggag       300
     ggagggggga agtgtgattg gaaactgagt aatcttactt tcgaagtgaa actgaaagat       360
     acgtcaacaa ttgcgcctct tattgacgat aattttggat ttaaaacgac atttgttatt       420
     gatggtaatg caccacaaga atttgatggg ggatatataa aaaaaacagg taatttaaat       480
     gaagaaatta ctctatttcc tttactaaga gagaggttct taggggggca tagtcaatca       540
     ttttatttgg taggagagca tgatgttatg acatataaaa tggataatgg cagaaaaatt       600
     catcttaatg tcttatatga aaaaaaattt ttaactcatt ggaatggagg aaaaaataag       660
     gatgcagata catcaatgac ttatcctgac ggcacaataa tatacaatgg tgatgtaata       720
     ccagactttg ataaattaat gcgtattctt gaatcaagaa acagcaaaca aactaagatg       780
     tag                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page