(data stored in ACNUC1104 zone)

EMBL: FN667741.PE172

FN667741.PE172       Location/Qualifiers
FT   CDS_pept        complement(166394..167158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0036"
FT                   /locus_tag="XBJ1_0176"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0176"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79327"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYE9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79327.1"
FT                   /translation="MKFLCNKSAFSSLLAVFFIQGCAQSDSFSPPMNGENIHFTATMPD
FT                   ELDALPISAMYRSEICRKERRTANMKSYSVPGFHRATYPLSIGQPNQVEVSVPKEGGGK
FT                   CDWKLSNLTFEVKLKDTSTIAPLIKNNFGFKTTFVIDGNAPQEFDGGYLKINGNLHEKI
FT                   ILFPLLTKLFLSVNETSFYLIGKGDPLTYKVGATKNINLSYIYIKKMLSVWTDRKNNDR
FT                   PFMTYPNGDIVYGEVRPEYEILMRILESRNSK"
     atgaaatttc tatgcaataa aagcgcattc tcctccttgc ttgctgtgtt tttcatacaa        60
     ggatgcgcgc aaagcgactc attctctcca ccgatgaatg gagagaatat tcattttacg       120
     gccactatgc ctgatgagtt ggatgcctta cccatttcag ccatgtatcg ttctgaaatt       180
     tgccgcaaag aacgccgaac tgcgaatatg aaatcgtatt ctgttccggg ttttcatcgt       240
     gcgacctacc cgctatcaat cggtcagcca aatcaagttg aggtcagtgt ccctaaggag       300
     ggcgggggga agtgtgattg gaaactgagt aatcttactt tcgaagtgaa actgaaagat       360
     acgtcaacaa ttgcgcctct tattaaaaat aattttggat ttaaaacgac atttgttatt       420
     gatggtaatg caccacaaga atttgatggc ggttatttaa aaataaatgg aaatttgcat       480
     gaaaaaataa ttttatttcc ccttctaaca aaattatttt taagtgtaaa tgagacttca       540
     ttttatctta tagggaaagg agatccgtta acgtataaag taggagcgac taaaaacatt       600
     aacctaagtt acatatatat aaaaaaaatg ctttcagttt ggactgatag aaagaacaat       660
     gacaggccat ttatgacata tcctaatggc gatattgttt atggcgaggt tagacctgaa       720
     tatgaaatat tgatgcgtat tcttgaatca agaaacagca aataa                       765
//

If you have problems or comments...

PBIL Back to PBIL home page