(data stored in ACNUC1104 zone)

EMBL: FN667741.PE176

FN667741.PE176       Location/Qualifiers
FT   CDS_pept        complement(169966..170760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0037"
FT                   /locus_tag="XBJ1_0180"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0180"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79331"
FT                   /db_xref="InterPro:IPR025391"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYF3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79331.1"
FT                   /translation="MENAIPAEDTESPVSWQEWLNKSNDAPVFFILNSLAKPDPVAHFY
FT                   LNDWVEEAFPLYSGTPMRKMLKQSPWLVQAKVNHLFQIGAVLDKHELSDNSWGWAYRSH
FT                   KSWQEQLTHWQRRQLVTLNGEQVIFRMMDTRVFGAMVSAFTPSDWSLMLTPVTELMIDL
FT                   SQTTHFHRPKECGQGNDDIPFTLGEHLQLVWLHSPYGLKVLSSSLYNDLWENHGVMAKK
FT                   LDQPEGSLEPRIEQWLRQKLEAGQRIENMSGQNYLLAMEQEK"
     atggaaaatg caattcccgc agaggacaca gaatccccgg taagctggca agaatggctg        60
     aataaatcta atgatgcgcc cgtatttttt atcctcaatt cactggcgaa acctgatccg       120
     gtggcacact tttatctcaa tgactgggta gaagaagctt ttccgttata tagcggtacg       180
     ccgatgcgca aaatgctgaa acaaagcccg tggctggtgc aggcgaaagt aaatcattta       240
     tttcagattg gtgcagtgct agataaacat gaactcagtg acaacagctg gggttgggct       300
     tatcgaagcc ataagtcgtg gcaggaacag cttacccact ggcaacgacg acaattggtg       360
     acgttgaatg gcgaacaagt gatatttcgc atgatggata cacgggtatt tggcgcgatg       420
     gtatcggcct tcacgcccag tgactggtca ctgatgctga ctcctgtcac ggaactgatg       480
     attgacctgt cccagaccac acatttccac cgtccgaagg aatgtggaca aggcaatgac       540
     gatattcctt ttacattggg cgaacaccta caactggttt ggctgcattc gccttatggc       600
     ctgaaagtct taagcagctc tctctataac gatctatggg aaaaccacgg tgtaatggcg       660
     aagaaattgg atcagccaga aggcagttta gaaccacgga ttgagcagtg gttgagacaa       720
     aagctggaag ccggacaacg tattgaaaat atgtccggtc agaattatct attggctatg       780
     gaacaagaaa aataa                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page