(data stored in ACNUC1104 zone)

EMBL: FN667741.PE178

FN667741.PE178       Location/Qualifiers
FT   CDS_pept        complement(172728..174485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0037"
FT                   /locus_tag="XBJ1_0182"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0182"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79333"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYF5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79333.1"
FT                   /translation="MKNNKESMYLRERAYMRELAQRVAKESPHLADFLLASHDPDIERV
FT                   FEAFALLIAHLRDKLEDDFPEITHGILSRIWPLALSPIPPTTVMQFHPTDGEHQGAVDI
FT                   PAGTPVSAHVNGQLLTFKTCRSLHIEPLIVLDRAVKKTGTHSEIVLTLCQTGIPSPVWQ
FT                   SGSLSFFLGTDSEQAALLSLWLDQHISDVSLRVRGEQRELSCFPYGWHNLFDTPILPME
FT                   KHTYAGLQSLIEYYALPQLYNFMTVDISDYCREVPLNADGTFELIFRFEGELPLEDVDD
FT                   AFMLGCVPAIHLENLTSLPIPLTPENHRYPLPLGESVRLFRLRDIQVIQQPDEKQQRGT
FT                   PYRYLPIDQFTPAMGWLAEDGEADTFYYLLQTARDLPGRLTHQLHFFDLTGRPAVNLPE
FT                   IAVACHSWGYHEQAIALEKGTLTVMQEGSPSHLNVHNITPVATDYPSMLQDNSGWPLLS
FT                   CLSSPPMLLFTTESLKHFLRLFDPYAELNRPLSRHIRRHIDGIVRVEERLTDRMYKGRP
FT                   VRGHLLSLTLNPDGYANPGEMYRFCRLINQAMACFVGQSTFVKLNVYTPNCHKALWEFW
FT                   EVYGLRRDM"
     atgaaaaaca acaaggagtc tatgtacctg cgggaaagag cctatatgag ggaactggct        60
     caacgcgtgg cgaaagaatc gcctcacctg gccgactttc tgcttgcctc tcatgatccg       120
     gatattgaac gtgtcttcga agcgtttgcc ctgctgatcg cccacttacg ggataaactt       180
     gaggatgatt tccccgaaat tacccacggc attctttccc gtatctggcc gctggccctg       240
     agtcccattc cgcctacgac ggtcatgcaa tttcatccca ccgacggaga acatcagggc       300
     gccgttgata tcccggcagg cacgccggtt tctgcccatg tcaacgggca gttactcacg       360
     tttaaaacct gccgttccct gcatatcgaa ccccttatcg tgctggacag ggcggtgaag       420
     aaaaccggca cacacagtga gatagtgctg acgctttgcc agacaggcat tccctccccc       480
     gtctggcaaa gcgggtcact gtcttttttc ctcggtacgg acagtgaaca ggcggcgcta       540
     ttaagcctgt ggctggatca acatatcagt gacgtcagcc tgagagtccg gggtgaacag       600
     cgagaactga gctgttttcc ttatggctgg cacaatctgt tcgatacccc catcctgccg       660
     atggaaaaac acacttatgc cgggcttcag tctctcattg aatattatgc gctgccccag       720
     ctttataact ttatgacggt ggatatcagt gactactgcc gtgaggtgcc gttgaatgcc       780
     gacggcacct ttgaactcat ttttcgtttt gaaggcgaat tgccactgga agacgttgat       840
     gatgccttta tgctgggctg cgtcccggcc attcatctgg aaaatctgac cagcctcccc       900
     attccgctga cgccagaaaa tcatcgctat cccctgccgc tcggggagtc cgtgcgattg       960
     ttccggctgc gcgatattca ggttattcag cagcctgatg agaaacagca acgcggcacg      1020
     ccataccgct acctgcccat tgaccagttt accccggcaa tgggctggct ggcagaagac      1080
     ggggaagctg acacttttta ctacctgctc cagacagcgc gtgatttgcc gggaaggctg      1140
     acgcaccagc tccatttttt tgacctgacc ggccgacccg ccgtgaactt accggagatc      1200
     gccgtcgcct gtcattcctg gggttaccat gaacaggcca ttgcgctgga aaaaggcacc      1260
     ctcaccgtga tgcaggaagg ttccccgtcc catctcaatg tgcacaatat tacgccggtc      1320
     gccaccgatt acccgtcgat gttacaggat aattccggct ggccgctgct ttcctgcctc      1380
     tccagcccgc cgatgttgtt atttactacc gaaagcctga aacatttcct ccgcctgttt      1440
     gacccttacg ccgaactcaa tcgtccgctg agccgccata tccgccggca tattgacggc      1500
     atcgtccggg tggaggaacg cctgaccgac aggatgtata agggcagacc cgtccggggt      1560
     cacctgttgt cactcacact gaaccctgac ggctacgcca atccggggga gatgtaccgt      1620
     ttctgccggt tgattaatca ggctatggcc tgttttgtcg gccagtccac cttcgtcaag      1680
     ctgaatgtgt ataccccgaa ctgtcacaaa gccctgtggg aattctggga agtctatgga      1740
     ttacgcaggg atatgtaa                                                    1758
//

If you have problems or comments...

PBIL Back to PBIL home page