(data stored in ACNUC1104 zone)

EMBL: FN667741.PE189

FN667741.PE189       Location/Qualifiers
FT   CDS_pept        184932..185780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0040"
FT                   /locus_tag="XBJ1_0193"
FT                   /product="putative amino acid-binding protein (ABC
FT                   superfamily, peri_bind)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0193"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79344"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYG6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79344.1"
FT                   /translation="MKFRNQSRVATVALLTSLALVSGVAKADKLDDIKKTGTVRIAVFD
FT                   SNPPFGFIDPQTKKLAGYDVDIANAVASDLGVKLELRPTNPANRIPLLSSKKIDLIAAN
FT                   FTITDERAKQVNFSIPYFATGQKFIARKGVLKTPDDIAKLRIGADKGTVQEITLRERYP
FT                   TAKVISYDDTPLAFAALRNGNVQAITQDDAKLVGLLANVPEAQKADFEISPFSITREYQ
FT                   AVAATKGEDRLINAVNQTLLKLEKDGDAEKIYNRWFGAETKSAQPRGDFKFAPLDSQAK
FT                   P"
     atgaaatttc gcaatcaatc ccgcgtagcg actgttgcgc tgctgaccag tctggcattg        60
     gtttctggtg tggcgaaggc agataaactt gatgatatta aaaaaaccgg tacggtacgg       120
     attgcggtat tcgacagtaa cccaccgttt ggttttattg atccgcaaac gaaaaaactg       180
     gcgggctatg atgtggacat cgccaacgcg gttgccagtg atctcggtgt aaaactggaa       240
     ttacgtccga ctaacccagc caaccgtatt cctctgctat cttccaagaa aattgactta       300
     attgccgcta atttcacgat caccgatgaa cgtgccaaac aggtcaattt ttccatccct       360
     tattttgcca ccggacagaa gttcattgcc cgcaaaggtg ttctgaaaac cccggatgat       420
     atcgctaagc tgcgtattgg ggcagataaa ggcactgtac aggagatcac gctgcgtgag       480
     cgttatccga cagcaaaagt catctcttat gacgatactc cactggcatt tgcggcctta       540
     aggaatggta acgttcaggc gatcacgcag gatgatgcga aattggttgg tttgctggca       600
     aacgtaccgg aagcgcaaaa agcagatttt gaaatttcac ccttcagcat tacccgtgaa       660
     tatcaggcgg tagccgctac caaaggagaa gatcggttga ttaatgcggt taaccagacg       720
     ctgctgaaac tggaaaaaga cggtgatgca gagaagatct acaaccgttg gtttggtgct       780
     gagacgaaat cggctcagcc gcgtggtgat tttaaattcg ccccattaga cagtcaggca       840
     aaaccttaa                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page