(data stored in ACNUC1104 zone)

EMBL: FN667741.PE193

FN667741.PE193       Location/Qualifiers
FT   CDS_pept        187656..191441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0197"
FT                   /product="putative invasin"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 9529069; Product type pf : putative
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0197"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79348"
FT                   /db_xref="GOA:D3UYH0"
FT                   /db_xref="InterPro:IPR003344"
FT                   /db_xref="InterPro:IPR003535"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR024519"
FT                   /db_xref="InterPro:IPR038177"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYH0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79348.1"
FT                   /translation="MFSYFSKIIRFVIVLYVLILPSTMMNAFADGNVLIEKTDNHHVSN
FT                   KTSDIDFSVNDSSKKFLNSTTNKKDTIQKNEDISEPDTPNSIARHLQTAGNMLSSSPSQ
FT                   LAEQAKSYALGKLNSTVNNEAQKWLSQFGTARINFALDKKGKLENSAFDILFPLYDNKA
FT                   DWLLFSQVGYRNKDSRNTLNFGLGGRYFQNNWMYGLNTFFDHDFTGKNRRLGLGGEIWG
FT                   DYLKLSANAYYRLSDWQHSRDHKDYYERPANGYDINGEFFLPAYPNLGAKLTYEQYFGD
FT                   NVTLFNRDTKQKNPSLAKLGLTYTPIPLVTIGVDYKQGGSGHTETQFLANFNYRLGVPL
FT                   SVQLSSDNVASMRTLAGSRYDLVERNYNIVLDHQKKQNLQLSLPGEIVGYSHEQKTVTA
FT                   KFHDSSIKKVEWISNGTFTDNKGQLSDNKDHTATITFPKYSPDGNNNYPILAIGMLENN
FT                   QKLPPVQMHVIVRPFVVKKAEEGTSYITPAGPLPASGKDKDAYTITPVITFDTPVGAPV
FT                   KNATIDDVKWITEPPADGKSGLKLSWEKQETTKTDENGKLQAVTLTSTKPQQNVKVYLQ
FT                   MGDADKEKQLVGTVSFGEDTARFHVNSIQVEPKETLTADGIQAYTYTALVLDGNNQPVK
FT                   RQKIDKVHWDHDKEDKTGLKWKSRGDTTDEEGKLTAELISSDPVKDVMVTLSIEGNTDK
FT                   SAKADKSVSFDAANVNLGLSKVSPILVRDTYTLKVTAKDASDNPETNKKVTWPQSQSLP
FT                   QGVILTPASSITDGNGEATATLTSTEEQTVDVTVSVEGVGEKKTSVEFKWPTITFQPAS
FT                   PKNGVVADGKKGYQFIAKVVGADGQTPYTDKVFQFKWHLQLSQDAVQGKTYLLHEVTDN
FT                   QNKTWTAQLASTQTQPKPVEGAKVCLAIEGGPSTSMACSEPVSFVPLPANVEIKSIEVN
FT                   FDPQKPLKGNWSDSYLYKALVFDKNTKEKLANYKFKPSEIHWSRDPDSGKVDDQSLALF
FT                   DQDLETDPDGYLTVKLKSYVGIKGVKVKLMISTLYGNEPGAAETAVDFEVAPQLAGLYL
FT                   FKKSDPTNVNKFFPEQERPYNAIGGDMRGELRTLDNKPLDNPEYTWEPKSTDTILPGEN
FT                   KGTFMINNFGKVTINAQVKTSYGNNLFYERWYVYKINMLRLFNRAGQRDSLYDLFDEKI
FT                   RCENIASSKAYTPNLKNIKGSGKGEALSEEFPNAYSWGLFDGLDFPNTREKEYFARFRV
FT                   DKGESPSNGYELYNAAYDKMMDSSITSAFLICVTGH"
     atgttttcat attttagtaa aatcattcgt tttgttattg tgttatatgt attaattcta        60
     ccgtctacaa tgatgaatgc ctttgcggat ggcaatgttc tgattgaaaa aacagataat       120
     catcacgtaa gtaacaaaac gtctgatata gacttttcgg ttaatgattc aagtaaaaaa       180
     ttcttgaatt cgacgaccaa taaaaaggat accatacaaa aaaacgagga tatctcagaa       240
     cccgatacac ctaatagcat tgcaagacat cttcagaccg caggcaacat gctgtcctct       300
     tctccttcgc aattggccga acaagctaaa tcttatgcct tgggaaaatt aaatagtacc       360
     gtcaataatg aggcacaaaa atggttatct cagttcggta cggccagaat taattttgcg       420
     ctggataaaa agggaaagct agagaacagt gcgtttgata tattattccc cctttatgac       480
     aataaagcgg actggttgtt attttctcaa gtcggttatc ggaataaaga cagccggaat       540
     acactgaact tcggtttggg aggccgttat tttcagaata actggatgta tggcctgaat       600
     accttttttg accatgattt caccggcaaa aacagacgat tgggattggg cggggaaatc       660
     tggggggatt acctgaaact ctcggccaac gcgtattatc gcttaagtga ctggcagcat       720
     tcacgggatc acaaagacta ttacgaacgt cccgccaatg gttatgacat taacggggaa       780
     ttcttcctgc cggcttatcc caatctgggc gccaagctga cctatgaaca atatttcggt       840
     gataacgtga ccctgttcaa ccgggatact aaacagaaaa accctagtct ggcaaagtta       900
     gggctgacgt atacccccat tccgctggtg acgataggag tggattataa acagggggga       960
     agcgggcata ccgaaaccca gtttttagcg aattttaatt acagactagg cgtcccgctc      1020
     agtgtgcagt tatcctcgga taatgtcgca tctatgcgta cgttggcagg cagccgttat      1080
     gatttggttg agagaaatta caatattgtt ctggatcatc agaaaaaaca aaacctgcaa      1140
     ttgtccctgc cgggagagat tgtgggttat agccatgaac agaagacagt cacagctaaa      1200
     ttccacgatt catctattaa gaaggttgag tggatatcta atggcacgtt taccgacaat      1260
     aaaggccaac tgtctgacaa caaagatcat actgcgacca ttacttttcc caaatattca      1320
     cctgatggta ataacaatta cccaatcctt gcgattggaa tgctggagaa caaccagaaa      1380
     ttaccccccg ttcagatgca tgtgattgtc aggccgtttg tggtgaaaaa agcggaagaa      1440
     ggcacatcat acatcacccc cgcagggcca ttacccgcca gtggtaaaga taaagatgcc      1500
     tataccatta cgccggtgat tacttttgat accccggtag gcgccccggt aaaaaatgcc      1560
     acgattgatg atgtcaaatg gataactgag ccgcctgctg atggtaaatc tgggctgaag      1620
     ttgagttggg aaaaacaaga gacaactaag acggatgaga atggaaagtt acaggccgtg      1680
     actttaacca gtactaaacc ccagcagaat gtaaaagttt atttgcagat gggcgatgct      1740
     gataaagaga agcaattagt gggaacggtg agttttgggg aagataccgc gcgttttcat      1800
     gtaaacagta ttcaggttga acccaaagaa acgctgactg ctgacggaat tcaagcctat      1860
     acatatacgg cgctggtatt ggatggcaac aatcagccag tgaaaaggca gaaaattgat      1920
     aaggttcact gggatcatga taaggaagat aaaacgggat tgaaatggaa gagcagggga      1980
     gatactaccg acgaagaggg gaaattaacc gcggaattaa tcagctctga tccggtaaaa      2040
     gatgtcatgg tcacgttatc catagaaggg aatacggata aatctgcaaa agcggataaa      2100
     tcggtttctt ttgacgcagc aaacgtcaat ttgggacttt caaaagtcag cccgatattg      2160
     gtgcgtgata cttatacttt gaaggtaacg gctaaggatg ccagtgataa tcctgagaca      2220
     aataaaaagg tgacatggcc gcaaagtcaa agtctgccgc aaggggtaat actgactcca      2280
     gcgagtagta ttactgatgg taatggggag gcgactgcga cattaaccag tactgaggaa      2340
     cagactgtgg atgtcacggt ttctgtagag ggtgtcggag agaagaaaac gagcgtggag      2400
     tttaaatggc caacgattac gttccagcct gcttcgccaa aaaatggtgt tgttgctgat      2460
     gggaagaaag gctatcaatt tatcgcaaag gtcgtgggcg ctgatggaca aacaccttat      2520
     acggataagg tgtttcaatt taagtggcat cttcagcttt cacaggatgc tgttcaggga      2580
     aagacctatt tattgcatga agtcacagat aatcagaata aaacatggac agctcaacta      2640
     gccagtaccc agactcagcc aaaacccgtt gaaggtgcaa aagtttgttt ggcgattgag      2700
     ggagggccat cgacatcaat ggcttgttca gagccagtga gttttgttcc acttcccgcg      2760
     aatgttgaaa tcaaatctat tgaagttaat tttgaccctc aaaaaccatt aaaaggtaat      2820
     tggagtgatt catatctcta taaggcgttg gtttttgata agaatacaaa ggaaaaactg      2880
     gctaactata aatttaaacc cagtgaaata cattggagcc gtgatccaga ctccggcaag      2940
     gttgatgatc aatctcttgc tttatttgac caagatcttg aaacagatcc cgatggttat      3000
     ttaacggtga aactgaaaag ctatgtgggg attaaaggcg ttaaggtgaa attgatgata      3060
     tctactctgt atggtaatga gcctggggca gctgaaacag cagtcgattt tgaagttgca      3120
     ccacagttag ctgggcttta tctctttaag aaaagtgatc caacaaatgt taataagttc      3180
     tttcctgaac aggaaagacc ttacaatgcc attggtggtg atatgagagg ggagctaaga      3240
     acgctggata ataagcctct tgataacccg gaatatacat gggagcccaa aagcacagat      3300
     acaattctac ccggtgaaaa taaaggtaca tttatgatca acaattttgg aaaagtgaca      3360
     atcaatgctc aagttaaaac atcctatgga aataatttat tttatgaacg atggtatgta      3420
     tataaaatta atatgcttag actttttaat agggcaggtc agagagattc actttatgat      3480
     ctttttgacg agaaaataag gtgtgaaaat attgcttcct caaaagcata tacacccaat      3540
     ctaaaaaata tcaaagggtc aggaaagggt gaagcgcttt ctgaggagtt tcctaatgct      3600
     tattcttggg gattatttga tggtttagac tttcctaata cgagggaaaa agaatatttt      3660
     gctagattca gagttgataa aggtgaatca ccaagtaatg ggtatgagct ctataatgct      3720
     gcctatgata aaatgatgga cagtagcatt actagtgcct ttttaatttg tgtgactggt      3780
     cattaa                                                                 3786
//

If you have problems or comments...

PBIL Back to PBIL home page