(data stored in ACNUC1104 zone)

EMBL: FN667741.PE200

FN667741.PE200       Location/Qualifiers
FT   CDS_pept        197347..197535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0042"
FT                   /locus_tag="XBJ1_0204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0204"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79355"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYH7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79355.1"
FT                   /translation="MDIKHILTNNQFRSILTLYKITDNRIRNSDSLLVDEPDIVRIKDK
FT                   ITSANESAQKSLCYLTH"
     atggacataa aacatatatt aactaacaac caattcagaa gtattttgac tctgtataaa        60
     atcacagata atagaatcag aaatagtgat tctttacttg tcgacgaacc ggatatcgtc       120
     aggattaagg ataaaataac gtctgccaat gaatccgcac aaaaatcatt atgttattta       180
     actcattga                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page