(data stored in ACNUC1104 zone)

EMBL: FN667741.PE202

FN667741.PE202       Location/Qualifiers
FT   CDS_pept        complement(199038..200507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0206"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0206"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79357"
FT                   /db_xref="GOA:D3UYH9"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYH9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79357.1"
FT                   /translation="MRFFDTSSYRMPLFLWITGYALLWVVASYTLDPTVPYDAVEALNW
FT                   GINGEWGSPKNPWLVGSVMLPAIHISTISLSFYWYLTHFLAIAIGMLGVWRLAFRLTGK
FT                   VELAWLAMLTLNLSGIINFDIIPYNDNYLLVMLWPWALLFFLRAIDDHPKWWLAFALTT
FT                   GLATMGKYSSLSIIGSVFLLSLFVPRVRRSYREPLFYLAIALWFMLILPNVWWLVHNDF
FT                   AAFKWVDSQIQQGFNLHTTRAVLSVFYPLLIVGAFIYLSGGRIGWPKQQSNALANIVIL
FT                   LPLLLIYGWFSFNQGGRMTEWLQPFMTVAPALLVGSLTVLPRKPLKNTLRGLAVFAVLV
FT                   WIGYVGVMITNVRGAGQKFVGIKTFANQLDQRWNELYPTPLRYVGGEYLHQWLTFYSHY
FT                   RPETIQPWELGNGEPPNVYNRHIKESSIVKEGALLVGEKGKSCEQENFQSTLKQWPVLV
FT                   ISYKEEFSFRPQPSAKTETVCIGFVTPENNQ"
     atgcgttttt ttgatacttc gtcttatcgc atgccgttgt ttctttggat cacgggctat        60
     gcgcttttgt gggtagtcgc aagctacaca ctcgacccta ctgtacctta tgatgctgtc       120
     gaagccttaa attggggtat aaatggagaa tggggatcac ccaaaaatcc gtggctagtg       180
     ggctcagtga tgctacccgc cattcacatc agcacaattt ccctcagttt ttactggtat       240
     ttgacccact ttcttgccat tgccatcgga atgctgggtg tctggcgatt agctttccgg       300
     ttgacaggca aagttgaact ggcgtggctt gccatgctga cactgaatct gtccggcatc       360
     atcaacttcg atatcattcc ttataatgat aattacctgt tagtcatgct ctggccgtgg       420
     gcactactgt ttttcctacg agccattgac gatcatccca aatggtggct ggcattcgcc       480
     ctcaccacag ggctggcaac gatgggaaaa tattcttcac tttctatcat tggctccgta       540
     tttttgctct ctctgttcgt acccagagta cgccgtagct atagagagcc cctgttttat       600
     ctcgctatcg cactctggtt catgctgata ttgcccaacg tctggtggct ggtgcataac       660
     gacttcgccg catttaaatg ggtcgactcc cagattcagc aaggctttaa cctgcacacc       720
     acgcgagcgg tactttccgt gttctatccc ttgctcatcg ttggtgcgtt catttacctg       780
     tcaggcggac ggattggctg gccgaaacag caatccaacg cgctggccaa tatcgttatc       840
     ctgctgcccc tgctgctgat ttatggctgg ttttccttca atcagggcgg gcgaatgacc       900
     gagtggctac aaccatttat gacggtagca cctgcgctgc tcgtcggttc actgacggta       960
     ctcccccgca agcccctgaa aaacacacta cggggtttgg cagtctttgc ggtattggtt      1020
     tggattggct atgtcggtgt gatgataacc aatgtccgtg gtgccgggca aaagttcgtt      1080
     ggtataaaaa cgttcgctaa ccaactggat cagcgctgga atgagcttta tccgactcca      1140
     ttgcgttatg ttggcggaga atatctgcat caatggctga cgttttacag tcattaccgc      1200
     ccagaaacaa tacagccttg ggagttaggt aatggtgagc cccctaatgt gtataatcgc      1260
     catatcaaag agagcagtat tgtgaaagag ggtgcgttat tggtgggaga gaaaggtaag      1320
     agctgcgaac aggaaaactt ccagtctaca ctcaagcaat ggccagtgtt ggtcatcagc      1380
     tacaaggaag aattctcctt ccggccacag ccgagtgcca aaactgaaac cgtctgtatc      1440
     ggtttcgtta cccctgaaaa taatcagtaa                                       1470
//

If you have problems or comments...

PBIL Back to PBIL home page