(data stored in ACNUC1104 zone)

EMBL: FN667741.PE211

FN667741.PE211       Location/Qualifiers
FT   CDS_pept        complement(214478..215995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0045"
FT                   /locus_tag="XBJ1_0215"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0215"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79366"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYI8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79366.1"
FT                   /translation="MIKVSVSVKPNSDVIISQEFIAEIKLTSNIPIDNSISISLENTSY
FT                   ISPVGKISSFTPSYNNTSGSFFVRLLVSDKITSGELVSFDIKSSYFGTKHVEYVAKHIQ
FT                   QETLSLKFYKKYLPTPDQPNFPSQGEICSKVMTTIKSSDGQPLSGTPIFIPYLYNFKDF
FT                   DIYDSEKNKIEVTSAPMKGFFINSNEKGEVIFYVYPHIGVATKITLDSMIYNATSSIHS
FT                   MNELYVASSQPQGNDSLLDPPDIENIHGENLTSPNSFIFKTKVDQYDNAKSQDTILFFV
FT                   NNIFTGYAFTIESIDDLGGYSIKLPYKIFEKYKDVACSFYYIIFSVNENVYYSYPLSIV
FT                   FKGGVPNTPQPDINRIYNTCVVYNSAGISPDNILQEMDYVDSTEISNYRNNPDNAGLFV
FT                   QIMGTNDLKDNSNVPLGSEVFLNLYINSSTKTVHHSLKKTMQNLPDGNNNSAKLIFNIP
FT                   HSCLIDCLAYPDRGGDIYFDYQIGFDNDDDLTYGKVWQGRIDTPIID"
     atgattaaag ttagtgtttc tgtaaaacca aactctgatg taatcatcag tcaagaattc        60
     atagcagaaa taaaattaac atccaatata cctatagata attctatttc catctcttta       120
     gaaaatacga gttatatctc ccctgttgga aaaatttcgt ccttcacccc atcttataat       180
     aatacatcag gatcattttt tgtcagatta ttggtatctg ataagatcac ctcaggtgag       240
     cttgtttctt ttgatatcaa atcctcatat tttggcacaa aacatgttga atatgtagct       300
     aaacatatac aacaagaaac attatctctt aaattttata aaaaatattt acctacacca       360
     gatcaaccta attttccttc acaaggagaa atctgcagta aggtcatgac aactattaaa       420
     tcttcagatg gacaaccatt atctggaacg ccaatattta ttccttatct atataatttt       480
     aaggatttcg atatctatga ctctgagaaa aataaaattg aagttacttc tgctcctatg       540
     aaaggttttt ttataaactc aaatgaaaag ggtgaagtga tattttatgt ttatcctcat       600
     ataggagtcg ctactaagat aactttagat tcaatgattt ataatgcaac atcttctatt       660
     cattctatga acgaattata tgttgccagt agccaacctc aaggtaatga tagcttatta       720
     gatccccctg atattgaaaa tatacatgga gaaaacttga catcgcctaa ttcttttata       780
     ttcaaaacca aagtagacca gtatgataat gcaaaatctc aagacacaat attgttcttt       840
     gttaacaata tatttactgg ttatgcattt actatcgaaa gcattgatga tttaggtggg       900
     tattctataa aactacccta taaaattttc gagaaatata aagacgtcgc ttgctcattt       960
     tattatatta ttttttctgt taacgaaaat gtttattatt catatccatt gagtattgtt      1020
     tttaaaggag gagttcctaa tacaccccag ccagacatca atagaatata caatacttgt      1080
     gtagtttata atagtgctgg tatttcccct gataacattc tacaagaaat ggattatgtt      1140
     gatagcactg aaatatctaa ctataggaac aatcctgaca atgctggatt atttgttcaa      1200
     attatgggaa ccaacgatct aaaagacaat tcaaacgtgc ctcttggttc agaggttttt      1260
     ctaaatttat atattaattc tagtactaaa acagttcatc attcacttaa aaaaacaatg      1320
     caaaacttac cagacggaaa taataattcg gcaaagttaa tatttaatat accccatagc      1380
     tgtttaattg attgtttagc ttatccagat agaggcggtg atatttactt tgattatcaa      1440
     attggatttg ataatgacga tgatctcaca tatggtaaag tctggcaagg acgtatagac      1500
     accccaatta ttgattga                                                    1518
//

If you have problems or comments...

PBIL Back to PBIL home page