(data stored in ACNUC1104 zone)

EMBL: FN667741.PE213

FN667741.PE213       Location/Qualifiers
FT   CDS_pept        complement(216152..217747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0045"
FT                   /locus_tag="XBJ1_0217"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0217"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79368"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYJ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79368.1"
FT                   /translation="MENTIISSIPTKSNIAKVQLLKMTITFLKTPEGNFSPNASFDIIK
FT                   SVNLKPVHPSYTIQTGGSIEIAFTLEKELADRSTVSFDIVPHNASGFLTTSFSYTVVEI
FT                   DNNSLSLTFGNEYLNAITKVENVSSNIPPTGKIYSKVFATIKAKNGGQSVSGIPITIMS
FT                   DHNTSLDNVRTFRENKSQSSEITKKTLYNRPVFYLETEQDGMVVFYVYPDNNTEFILNL
FT                   QARVTDTQSFQLSKNSLFVIDDDPTNPGNLSNINTDFLAPPSILEVSDGALIGDPDSTT
FT                   FSVEVDPYNHPNRNDTILFYVNGSYSNQKIIVENKNNLGNYFIDLPYSIIPKNENIELS
FT                   YIVVTHDAKIKKSASLGFTYSGGGKSAPLDDINRIYDPCVVYSSFGASQGTALIHQGDL
FT                   INYFSISHDSNKKKSTALFIEIEGTNDITDKTKVPLGYNVVVTLYIDSYNKQFQHSFKV
FT                   ITMPATPVPHSSHTATHIFEIPIDYLNNIESYPNSSAGNIYFDYYAYDPSDPGNSGTKY
FT                   YGKIWQGKIDTERP"
     gtggaaaata ctataatttc atcaatacca acaaaatcaa atatagccaa agtccaatta        60
     ctaaaaatga caattacttt tttaaaaact cctgaaggaa atttttcacc taatgcctca       120
     tttgacatca taaaatcagt taatcttaag ccagtacatc ctagttatac aatacagaca       180
     ggaggctcaa tagagattgc atttactctt gaaaaagaat tagcagaccg aagtacagtt       240
     agttttgata ttgtacctca taatgcaagt ggatttctta caacatcttt tagttatact       300
     gttgtggaaa tagacaataa ctcattatcc cttacctttg gaaatgaata tttaaatgcc       360
     ataactaaag tagaaaatgt tagttctaat attccaccaa ctggtaaaat atactctaaa       420
     gtttttgcca caataaaagc taaaaacggt ggtcaaagtg tatctggaat tcctatcact       480
     ataatgtcag atcataatac tagtttagat aatgttagaa ctttcagaga aaataaaagt       540
     cagtcatctg aaataacaaa aaaaacctta tataacagac cagtttttta tttagaaaca       600
     gaacaagatg gtatggttgt tttttatgta tatccggata acaataccga atttatactt       660
     aatttacaag ccagagtaac tgacacacaa agttttcaac tatcaaaaaa cagtttattt       720
     gttattgatg atgatccaac taatccgggt aatctatcaa atattaatac tgatttttta       780
     gcccctccct ctattctaga agtatcagat ggtgcgttaa taggagaccc tgattcaaca       840
     actttttctg ttgaagttga tccatacaat catccaaata gaaatgatac tatattattc       900
     tatgtcaatg ggagttactc aaatcaaaaa atcattgttg aaaataaaaa taatctaggt       960
     aattatttta ttgatttacc ttactcgatt atacccaaaa atgaaaatat tgaattatct      1020
     tatatcgttg ttacacatga tgcaaaaata aaaaaatcag catcactagg attcacctac      1080
     agtggaggag gtaagagcgc acctcttgat gatatcaata ggatttacga tccatgtgtt      1140
     gtttattcta gttttggtgc ttcacaagga acggctctaa tccatcaagg tgatttaata      1200
     aattatttct ctatatctca tgattctaat aagaaaaaaa gcacagcgtt atttattgaa      1260
     atagaaggga ctaatgatat tactgacaaa accaaagtac cactgggtta taatgttgta      1320
     gtgacattat atatagattc ttataacaaa caatttcaac attcatttaa agttattact      1380
     atgcctgcaa cccctgttcc acacagcagt catacagcaa cacatatatt tgagattcct      1440
     attgattatc taaataatat agagtcatat cctaatagtt ctgctggaaa catctatttt      1500
     gactattatg cttatgatcc atctgaccca ggaaactctg gaactaaata ttatgggaaa      1560
     atttggcaag gaaaaattga cacagaaaga ccttaa                                1596
//

If you have problems or comments...

PBIL Back to PBIL home page