(data stored in ACNUC1104 zone)

EMBL: FN667741.PE224

FN667741.PE224       Location/Qualifiers
FT   CDS_pept        complement(226421..228232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0228"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0228"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79379"
FT                   /db_xref="GOA:D3UYK1"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYK1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79379.1"
FT                   /translation="MKWLGKFFVTLLLLLILAIIVIYIVVQTHWGTKQLNQWLNRQGHY
FT                   EISIDSISHNWLQPATLTLNNVNIHDKQSAFSLNVSTVNLDLKWQHLLTPRNLHRLTLQ
FT                   QGKLILAGDQLPPLLQADILQLNQMNIQLENPHTQIKGENITGGITPWMPAAGNPFGNG
FT                   QYQFSASTMSFNGIPFEKVIMQGSYQNKTLTIDTFGAAFLQGAISGDGRQLSDGSWRWN
FT                   NLLISNIRWQSPMTLSTLQEKTRHLPAIHVKDLNITNAKLQGKNWSVDYLDTTIKNLGL
FT                   VNGSWEAKDGLIDFNVMNMAFNNAQFSNTLGQLHFSGDTFTVAHLTTHYQKGLFNIQSE
FT                   WDRKNRQLTFNNSSVTGLVYDLPPTWRNDIKNAAPGWISGLTLNDISVNNTLLIDVNPD
FT                   FPFQLTTLSGHVDTMNILKNGRWGLWEGQASLQAASGTFNKIEITRPYLQLHATDDRLT
FT                   IDKLNAFNGHGLLQASGSAEQQTAQKPFELNFKGMNADLGILPRWGWIPLTMQGEGNFS
FT                   LALTGNLSADDIKGTINGTLTAEDKSSNKDSQSIVQGLILSSNCSPAGTVDGAAIAPST
FT                   EAHTAEAGNTRAESETAESKTCLKIKL"
     atgaagtggt tagggaaatt ttttgttact cttttgctgt tgctgattct ggcaattatc        60
     gtcatttata ttgttgtcca gacgcactgg ggaaccaaac aattaaacca atggctcaac       120
     agacaaggcc actatgagat cagcattgat agcatcagtc ataactggct gcaacctgcg       180
     acactgacgc tcaacaatgt gaatatccat gataagcaaa gcgctttctc actcaatgtc       240
     agtaccgtta atctggatct caaatggcaa cacttgctga caccgcgtaa cctccaccgt       300
     ctgacattgc aacaagggaa actgatactg gcaggcgatc aattgccccc cctcttgcaa       360
     gcagacattc tgcaactaaa ccagatgaat attcagttag agaaccccca cacacaaatt       420
     aaaggggaaa atatcacggg tggcatcacc ccttggatgc ctgccgcagg aaacccgttt       480
     ggcaatgggc agtatcaatt tagtgccagt actatgagtt tcaatggtat tccctttgaa       540
     aaggttatca tgcagggcag ctatcagaat aagactctga ctatcgacac ttttggtgca       600
     gcatttctgc aaggggctat ctctggggat ggccggcaat tatctgacgg cagctggcgc       660
     tggaataatc tcctgatcag caatatacgc tggcaatcac cgatgacatt gagcacgttg       720
     caagaaaaaa cccgtcatct tccggccatt catgttaaag acctcaatat cactaatgcc       780
     aagctgcaag ggaaaaattg gtctgtcgat tatctggata ccaccatcaa aaacctggga       840
     ctggtgaatg gaagctggga agctaaagat gggctgattg atttcaatgt catgaatatg       900
     gcattcaata acgctcagtt cagcaacacg ctggggcaac tccatttttc tggtgatact       960
     tttactgtcg ctcatctgac gacccactac caaaaaggat tattcaatat ccaatccgag      1020
     tgggatcgca aaaaccgtca actgacgttc aataacagct cagtaaccgg gctagtttat      1080
     gacctgccac ccacatggcg gaacgatatc aaaaacgccg caccgggatg gatttcagga      1140
     ctgacattaa atgatatcag cgtcaataat actctgctga ttgatgttaa tccggatttc      1200
     ccatttcagc tcaccactct ctcaggccat gtggatacca tgaatattct gaaaaatggc      1260
     aggtggggat tatgggaggg tcaggcatct ttgcaggcag ccagcggaac atttaataaa      1320
     attgaaataa ctcgtcccta tctgcaatta cacgcgacag atgacaggct aacgattgat      1380
     aaactgaacg ctttcaacgg tcatggatta ctacaagcta gcggttcagc tgaacagcaa      1440
     actgcccaaa aaccttttga gcttaatttc aagggcatga atgcggattt aggcatcctg      1500
     ccacgatggg gttggatacc acttactatg cagggagagg gaaatttttc cctcgccctg      1560
     acaggtaatc tctctgctga tgatattaaa ggcaccatca atggcacact gactgctgaa      1620
     gataaatcat caaacaaaga ttcacaatcc attgttcagg ggctaatttt aagcagtaac      1680
     tgctctccag ctggaaccgt agatggcgct gcaatagcac cttcaacgga agctcatacc      1740
     gcagaggcag gtaatacccg cgcagaaagt gaaactgccg agagtaaaac ctgcctcaaa      1800
     attaaactgt aa                                                          1812
//

If you have problems or comments...

PBIL Back to PBIL home page