(data stored in ACNUC1104 zone)

EMBL: FN667741.PE234

FN667741.PE234       Location/Qualifiers
FT   CDS_pept        239639..240940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0238"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0238"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79389"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR022223"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYL1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79389.1"
FT                   /translation="MVFKERQITFDNRSHQITNINIWTPDSQWLVYDVRPSGASFTGLT
FT                   IEKIHVGSRQVKVIYQAQDDAHVGVVTVNPQEPVRYAFIHGPEKPDTQWQYDFHHRRGV
FT                   IVSDAQPNVAVNIEALDITPPYTSGALRGGTHVHVFSPDGNRLSFTYNDHVMHERDPAL
FT                   DLRNVAVAIPLRAVIPPKKHPREYDGSYFSVIVSRTTPQPRSGSDEINRAYEEGWIGQR
FT                   GYPKENGQWQRWALAFIGDTCAENGEKIPEIYLVDLPDNNEDYAIEGKQPLAGTETTLP
FT                   APPAGVKQRRLTFTHQNRWPGVVNVPRHWLRTSPDGSKIGFLMKDEAGIVQLWYISPNG
FT                   GVPVQITHSTHHIQSAFNWDRRGRFIAFVCDNSIMLCDSQNGEMHRLTARTDDAPSADA
FT                   IVISPDDRYVAFMRDIDGYRQILVVETGITDVGE"
     atggtcttta aggaacgcca gattacattc gacaaccgta gccatcagat aactaatata        60
     aatatctgga ctcctgatag tcaatggctg gtatacgacg ttcgccccag tggtgcgtct       120
     tttacgggtc tcacgataga aaaaattcat gtcggcagta ggcaggtaaa agtgatttat       180
     caggcgcagg atgacgcgca tgttggcgtt gtgacggtaa atccacagga gcctgttcgc       240
     tatgcgttca tccacggccc agaaaagcca gatacgcagt ggcagtatga ttttcatcat       300
     cgccgaggcg tgattgtctc tgatgcccag ccaaatgtag ccgtcaacat tgaggcgctg       360
     gatattactc caccttatac atccggcgct ctgcgcggtg gtacgcatgt tcacgttttc       420
     agccctgatg gtaaccgttt gagttttact tataacgacc atgtgatgca tgaacgagat       480
     cccgcgcttg atttacgcaa tgttgccgtg gctattcctc tgagagcagt cattccaccg       540
     aaaaaacatc ccagagaata tgatggtagt tatttttcag ttattgtcag ccgtacaaca       600
     ccgcagccac gttctggcag tgatgagatc aatcgggctt atgaagaagg ctggattggg       660
     cagcggggat atcccaaaga aaatggtcag tggcagcgtt gggcgctggc ttttattggt       720
     gatacctgtg ctgagaacgg tgaaaagata cccgaaattt atctcgttga tttaccggat       780
     aataatgagg attatgccat tgagggcaaa cagcctttgg caggaacaga aaccacactg       840
     ccagcaccac cagcaggtgt gaaacagcgc cgtttaactt ttacccatca aaatcgctgg       900
     ccgggagtgg taaatgttcc ccgacactgg ctgagaacat caccggatgg cagcaaaatc       960
     ggctttctga tgaaagacga agcgggtatc gttcagttat ggtacatctc gccaaatggt      1020
     ggcgtgccag tgcagatcac tcacagtaca catcacatac agtcggcatt taactgggac      1080
     agacgtggcc gattcatcgc ctttgtttgt gacaacagta tcatgctctg tgatagccaa      1140
     aatggcgaaa tgcatcggct gacagcacgt actgatgatg caccttctgc ggatgcgatt      1200
     gtgatatcac cggatgaccg atatgtggct ttcatgcgtg atattgatgg ttatcggcaa      1260
     attttggttg tcgaaactgg catcactgat gtgggggaat ag                         1302
//

If you have problems or comments...

PBIL Back to PBIL home page