(data stored in ACNUC1104 zone)

EMBL: FN667741.PE257

FN667741.PE257       Location/Qualifiers
FT   CDS_pept        complement(268621..269139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0261"
FT                   /product="Hemolysin-coregulated protein Hcp(probable Type
FT                   VI secreted cytotoxin system component)"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 15659065; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0261"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79412"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYN4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79412.1"
FT                   /translation="MPTPCYISINGKTQGNITAGAFTAESVGNIFVQGHEDEMLVQEFD
FT                   HIVTVPTDPQSGQPSGQRAHKPFRFTVALNKAVPLLYNALASGEMLPTVELKWYRTSIE
FT                   GKQEHFFTTKLEDATIVDIDCKMPHCQDPSKAEFTQLIRVSLSYRKINWEHTTAGTSGS
FT                   DDWRAPIVA"
     atgccaactc catgttatat ttccatcaat ggaaaaactc agggcaatat tactgctggt        60
     gcattcactg ctgaatcagt aggtaatatt ttcgttcaag gtcacgaaga cgaaatgctg       120
     gttcaagaat ttgaccacat tgtcactgtc ccaactgatc cacagtcagg tcagccttct       180
     ggccagcgtg cgcataaacc attccgcttc accgttgcat tgaacaaagc cgttcctctg       240
     ctttacaacg cactggcttc tggcgaaatg ttacctactg ttgaattgaa atggtaccgt       300
     acttcaatcg aaggtaaaca agagcatttc ttcacgacca aacttgaaga tgcaactatt       360
     gttgacattg attgcaaaat gccacattgc caagatccat caaaagcaga atttactcaa       420
     ttaattcgtg tgtctctttc ttatcgtaag attaactggg aacacactac agcaggtact       480
     tctggttctg atgactggcg tgcgccaatt gttgcttaa                              519
//

If you have problems or comments...

PBIL Back to PBIL home page