(data stored in ACNUC1104 zone)

EMBL: FN667741.PE259

FN667741.PE259       Location/Qualifiers
FT   CDS_pept        270061..270558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0054"
FT                   /locus_tag="XBJ1_0263"
FT                   /product="conserved hypothetical protein (probable
FT                   component of the SST VI cluster)"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0263"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79414"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYN6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79414.1"
FT                   /translation="MSKNSPGSVAPKERINIKYVPNTGDQTAEVELPLNLLVVGDLKGK
FT                   KEDTPIEERQTVSVNKNNFNAVMNEANINLTFNVPNRLDEKNEEDMPVNLEIKSLSDFS
FT                   PDNIAKKVPELNKLLELREALVALKGPLGNIPAFRTRLQSLLDDESVREQLLKELEIVN
FT                   KK"
     atgagtaaga atagtccagg tagcgtagct ccgaaagaaa gaattaatat taagtatgtt        60
     ccgaatacgg gtgaccagac cgcagaagtc gaattaccgt tgaatcttct ggttgtcggt       120
     gatttgaaag gaaagaagga agatacgcca attgaagaac ggcaaacagt ttcagtcaat       180
     aagaacaatt tcaatgccgt aatgaatgag gcgaacatca atctgacttt taacgtccct       240
     aatcgtcttg atgaaaaaaa tgaagaagac atgcctgtta atctggaaat taaatcactg       300
     agtgattttt caccggataa tatcgcaaaa aaagtgcctg aattaaataa acttctggaa       360
     ctgcgtgagg cattggttgc actaaaaggc cctctgggaa atatccctgc atttcgtact       420
     cgcttgcagt cgcttctgga tgatgaatcc gtgcgtgagc aactcctgaa agaacttgaa       480
     atcgtcaata aaaaataa                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page