(data stored in ACNUC1104 zone)

EMBL: FN667741.PE263

FN667741.PE263       Location/Qualifiers
FT   CDS_pept        274297..275349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0054"
FT                   /locus_tag="XBJ1_0267"
FT                   /product="conserved hypothetical protein (probable
FT                   component of the SST VI cluster)"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0267"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79418"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYP0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79418.1"
FT                   /translation="MAGTDRSTLIDVITEQDPATPLALDISQYNFYQLVELLNQLAVAW
FT                   EKTGETDRPDRESVRFRASASLAFPTRDVISLSQTRRGYFELEVSFMGLHGSQSPMPGY
FT                   YLDSLAWEEAQNENRLTDFLNLFNHRLITLLHQIWRKYRYYVCFKKGGEDHFSQRMFSL
FT                   VGLGSDVNRRMLNINHSKMLAYAGLLASPGRSPEVICSLVSHCFDLQDVTLHGWQFRKV
FT                   TIPLDQQNRLGSERKGQVIGDSKLSMLGQNFTIGSWVGDYSGKFLLSINNLTRDRFLSF
FT                   LPDGKNYAPLVMFISFVMRSQFAWELRLGLAENQVSGMVLGAQQNNHLGWTSFLGEPEK
FT                   KPFVTISVME"
     atggccggta cagataggtc aacactcatt gatgtaatca ctgagcaaga tcctgccaca        60
     cccttggcat tggacatttc acagtacaac ttttatcagt tggttgagct gctcaatcag       120
     ctggcggtag cgtgggaaaa aacgggagag accgatcgtc ctgatcgtga gtctgttcgt       180
     ttcagagcca gtgccagtct ggcatttccg actcgtgacg tgatctcact ctcgcagacc       240
     agacggggtt attttgagct ggaagtctcc tttatggggc tacacggcag tcagtccccg       300
     atgccaggtt actatctcga ttcgctggct tgggaagaag cgcagaacga aaaccgactg       360
     acggattttc tcaacctgtt taaccatcgc ttaatcacgc ttctgcatca gatctggcgg       420
     aaataccgct attacgtctg ctttaagaag gggggagaag atcatttttc tcagcgcatg       480
     ttttcccttg tgggtctggg gagcgatgtc aaccgccgga tgctgaacat taatcacagc       540
     aaaatgctgg cctatgcagg gctgctggca agccccggcc gctcgccgga agtgatatgc       600
     agtttggttt cccactgttt tgatttacag gatgtcaccc tgcacggctg gcaattcaga       660
     aaggtcacta ttccccttga tcagcagaac cgcttgggaa gcgaaaggaa aggacaggta       720
     atcggtgact ctaaactgtc catgctgggg cagaatttca ccattggttc atgggtcggc       780
     gattacagcg ggaagttcct tctcagcatc aataatctga ctcgtgatcg gttcctgtct       840
     ttcctgccgg atggaaagaa ttatgcccca ttggtgatgt ttatttcttt cgtcatgcgc       900
     agtcaatttg catgggaatt gcgtcttggt ctggcagaaa atcaggtcag cggcatggta       960
     ttgggggcgc agcagaataa ccatctgggg tggactagtt ttctcggcga accggaaaag      1020
     aaaccttttg tcacaatttc agttatggaa taa                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page