(data stored in ACNUC1104 zone)

EMBL: FN667741.PE264

FN667741.PE264       Location/Qualifiers
FT   CDS_pept        275355..276650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0054"
FT                   /locus_tag="XBJ1_0268"
FT                   /product="Conserved hypothetical protein with FHA domain
FT                   (probable component of SST VI cluster)"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0268"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79419"
FT                   /db_xref="InterPro:IPR017735"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYP1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79419.1"
FT                   /translation="MEKQQPTLSLRVLNSEQLESGRSASCLFSAQGGTVGSSESHLWSV
FT                   QDQQGNIHPSQFSVQWRDGAFCLQVLAEPVQINNAALTPQSSLIRLQQGDQIKAGNLSI
FT                   KIHISFSDADRVDPSTVSPESLVSSYSNPLDAMMEGAVVQKAVFADDNSIAPTIQHSFS
FT                   DDPLRVLDSESLTTLKQQVEADDTEQLLPPDHFQSPPFANPISDNRGSVMDQEFLDLPG
FT                   ITSERQYADMDVDHVAITPLMRGLDAQLPLHDSQQANDFLQEMGKTMKAAIEGLLALQR
FT                   EQHGLRDKQLRPIEDNPLRLNMDYDTTMQVMFSDQKSPVHLSAPAAVSESLHNLQLHYQ
FT                   ANREAISAALDTMLEAFSPDQLLRRFSHYRRSNEVRNKDAAWAWEMYTNYYRELASSRQ
FT                   QGFEKLFREVYEQAYDRALRQGLEDSSNETFR"
     atggaaaaac aacaaccaac gctttcattg cgggttctca acagtgagca actggaaagt        60
     ggcagatccg ccagttgcct gttttcggca cagggcggta cggtcggtag cagtgaaagt       120
     cacctgtggt ctgttcagga tcagcaggga aatattcatc catcacaatt ctccgtgcag       180
     tggcgggatg gtgcattctg cctgcaagta ctcgcagaac ctgtgcagat caacaatgcc       240
     gcattaacgc ctcagtcaag tctgatccgt ttgcagcagg gagatcagat taaggcgggt       300
     aatctgtcta ttaagatcca catcagtttt tctgatgcag atcgtgttga tccttcgacg       360
     gtatcacctg aatccttggt atcgagttac agcaacccgc tggatgccat gatggaaggc       420
     gcagtagtac aaaaagccgt gtttgccgac gataacagta ttgctccaac gatccagcat       480
     agtttcagcg atgacccgct cagggtactc gatagcgaaa gcctgaccac gctgaagcag       540
     caggttgaag ctgatgatac tgagcagctt ttgccgccgg atcatttcca atcaccccca       600
     tttgctaacc ctatttctga taaccgaggc agtgttatgg atcaggagtt ccttgattta       660
     ccgggtatca cttccgagcg gcagtacgca gatatggatg ttgatcatgt tgccattacc       720
     cctctcatgc gtgggctgga tgcacagtta cctctgcatg acagccagca ggctaatgat       780
     tttctgcaag agatgggcaa aaccatgaaa gccgccattg aagggttatt ggctctccag       840
     cgtgaacagc atggactgcg tgataaacaa ctacgcccca tcgaagataa ccctctgcgc       900
     ctgaatatgg attatgacac caccatgcag gtgatgttct cggatcagaa aagcccggtt       960
     cacttgtctg cacctgcggc cgtctcggaa agtctgcata acctgcaatt gcattatcag      1020
     gccaatcggg aagccatttc ggcagcattg gacaccatgc tggaagcttt ctcccctgat      1080
     caattgctcc gtcgcttctc acattaccgc cgcagcaacg aagtcagaaa taaagatgcg      1140
     gcctgggcgt gggaaatgta caccaactat taccgtgaat tagcttccag ccgccagcag      1200
     gggttcgaaa agctattccg tgaggtgtat gagcaggctt atgaccgcgc actgcgtcag      1260
     ggcttagagg actccagcaa tgaaacgttc cgctag                                1296
//

If you have problems or comments...

PBIL Back to PBIL home page