(data stored in ACNUC1104 zone)

EMBL: FN667741.PE265

FN667741.PE265       Location/Qualifiers
FT   CDS_pept        276634..277188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0054"
FT                   /locus_tag="XBJ1_0269"
FT                   /product="conserved hypothetical protein (probable
FT                   lipoprotein of SST VI cluster)"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0269"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79420"
FT                   /db_xref="InterPro:IPR017734"
FT                   /db_xref="InterPro:IPR038706"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYP2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79420.1"
FT                   /translation="MKRSASHRVWAVGILLLSAMLLNGCSGAWNATKKVGQVIWDPSTP
FT                   VGKPDEQASVANITLLAEPNINPNESGEAAPVEMNLVYLSEDSRFLAADYDQLESDKLE
FT                   KALGKNYIDHQDYTLLPGQYKPLSTLILEKNNRYIGVIVHYADANQSEWKKIIRVKDIG
FT                   RHYNILVHVRNNDVELRKEEE"
     atgaaacgtt ccgctagtca tcgtgtatgg gctgtaggga ttttattgtt gtcagcgatg        60
     ttgctgaatg gctgtagcgg tgcatggaac gcgacaaaga aagtcggtca agtgatctgg       120
     gatccttcca caccagtagg aaaaccggat gaacaggctt ctgttgccaa cattacgtta       180
     ttggccgaac cgaatatcaa ccccaatgaa agtggtgaag cggctcctgt tgaaatgaat       240
     ctggtttatc tcagtgaaga ttctcgtttt ttggctgctg attatgacca gcttgaaagc       300
     gacaaactcg aaaaagcact ggggaaaaat tatatcgatc atcaggatta cacactatta       360
     ccggggcaat acaagcccct gtcaacgctg atattggaaa agaataaccg ttacatcggt       420
     gtcatcgttc actatgcaga tgcaaatcaa tctgaatgga aaaagatcat ccgagtaaaa       480
     gacatcggcc gccattacaa catcttggtg catgtcagaa ataacgacgt cgaacttaga       540
     aaagaggagg agtag                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page