(data stored in ACNUC1104 zone)

EMBL: FN667741.PE266

FN667741.PE266       Location/Qualifiers
FT   CDS_pept        277191..278543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0054"
FT                   /locus_tag="XBJ1_0270"
FT                   /product="conserved hypothetical protein (probable
FT                   component of SST VI cluster)"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0270"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79421"
FT                   /db_xref="InterPro:IPR010263"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYP3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79421.1"
FT                   /translation="MPGKNRVIWHEGLFIKPQHFQQQQKHNDYLAHSLVSVLAAYGHGF
FT                   SSLSINQDLLNLGRIGITEASGIMQDGTIFSAPSQDLLPKPLDIESVNDLKSKDIYLAL
FT                   PMSSDTIREIADKEAEMQSAVRYRELPSDVRDLHTKGGDSFALNLAQLTPVLMQGSEDM
FT                   SAYTAIPLCRIKEKQKDGTIVLDSEFIPTCLSIFVADKLRRFMVEIDGLLTERSRTLAK
FT                   RIGSPGQQGVADVAEFMMLQLLNRVQPLFNHYAKQTVLHPLHLYTQLLQTCGELRTFTD
FT                   ASRLPGNVLAYDHNNLTDTFQDAMHAIRDALNVVLTPRATSIVLKQNEGGIRVATLHDN
FT                   DLLRKAEFVLAISASTPQEQLRRQFVQQTKVTSMEKIRDLVSVQLPGVPLIALSAAPRQ
FT                   LPYHSGYTYFRLDQKSPAWKEIQQGNSIAFHVSGDFPDLDMQLWAIRGGKE"
     atgccaggca aaaatcgggt gatttggcac gaaggattgt tcatcaagcc acaacatttt        60
     caacaacaac aaaaacataa tgattatctg gctcatagcc tcgtatcggt gttggccgct       120
     tatggtcacg gtttcagctc cttaagcatc aatcaggatc tgctcaattt agggcgcatc       180
     ggcattaccg aagccagcgg catcatgcag gatggcacga tattctctgc acccagccaa       240
     gatctgctgc caaaaccgct ggacatcgaa agcgtcaatg acctgaaaag caaagacatc       300
     tatctggcat taccaatgtc cagcgatacc attcgggaaa ttgctgacaa ggaagcggaa       360
     atgcaaagcg cggtacgtta tcgggaactg ccgagcgatg tccgtgacct gcataccaag       420
     ggtggcgatt cctttgccct gaaccttgcg caattgacgc cggttctgat gcaaggctcc       480
     gaagatatga gtgcttacac ggcgatcccg ctgtgccgta tcaaagaaaa acagaaggat       540
     ggcactatcg ttctggatag cgaatttatt ccgacctgtc tgtctatctt tgtcgctgac       600
     aagttaagac gttttatggt ggaaatcgac ggcctgctga ctgaacgctc aagaacactg       660
     gccaaacgca ttggctcacc gggtcagcag ggcgttgcgg atgttgcgga gttcatgatg       720
     cttcaattgt tgaaccgcgt gcaacctctg ttcaaccatt acgcaaaaca gactgtcctg       780
     cacccgctgc atttatatac ccaactgctc cagacctgcg gtgagctgag aaccttcacc       840
     gatgcgagtc gcttaccggg gaatgtgctg gcgtatgacc acaataatct gacggatact       900
     ttccaggacg cgatgcatgc cattcgtgat gcactgaacg ttgttctgac accgcgtgca       960
     acgtcaattg tcctgaaaca gaacgaaggt ggtatccgcg tggcaacgct ccacgacaac      1020
     gatctgctgc gtaaagccga atttgtactg gctatcagtg caagtacgcc gcaggagcaa      1080
     ttacgtcgtc agttcgtgca gcaaaccaaa gtcacctcga tggagaaaat ccgcgatctg      1140
     gtcagcgttc agttaccggg tgtgccactg attgcattat ccgcggctcc gcgtcagctg      1200
     ccgtatcact ctggatacac ctacttccgt ctggatcaga agagtccggc atggaaagag      1260
     atccagcagg ggaattccat cgcattccac gtatcagggg atttccctga cttagatatg      1320
     cagctctggg ctatcagggg cggtaaggaa taa                                   1353
//

If you have problems or comments...

PBIL Back to PBIL home page