(data stored in ACNUC1104 zone)

EMBL: FN667741.PE269

FN667741.PE269       Location/Qualifiers
FT   CDS_pept        282037..282831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0054"
FT                   /locus_tag="XBJ1_0273"
FT                   /product="conserved hypothetical protein (probable
FT                   component of the SST VI cluster)"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0273"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79424"
FT                   /db_xref="GOA:D3UYP6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYP6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79424.1"
FT                   /translation="MKQRLKSALALLDDDTIEQLVDHFLLVSQSSRFDALLVFLLNTNE
FT                   NRLECYNLPELHQASSRRLNVDIDDVNNPLIQVLRKGTPTVWDSLNHGARIDDVHFRTF
FT                   VAELPHNCGLYAIPLFDCNGQACGVIAIFAEHVSHFINNENMFGLYCHVMQHRLKKLQE
FT                   LEQLRGQLRQIRQVFQVQQQKEKQLDELLASLSGSKPAGVSRISVDYSHIDNLPKAIEE
FT                   FESAVLVQRQRQYGNDTRLIAQSLGIATRTLVYKLAKYGCRL"
     atgaaacagc ggctgaaaag cgcgttagcg ttattagatg atgacactat agaacaactg        60
     gttgaccatt ttctgctggt aagccagagc tcgcgttttg atgccctgtt agttttcttg       120
     cttaacacca atgaaaacag gctggaatgc tacaacctgc cggaactcca ccaagccagc       180
     tcacgccggc tgaatgtaga tattgatgac gtcaataacc cgctgataca ggttctgcgc       240
     aagggaaccc cgacggtatg ggattccctg aatcacggcg cgcgtattga cgacgtgcat       300
     ttccgcacgt ttgttgcgga actgccgcat aactgcgggt tgtatgccat tcccctgttt       360
     gactgtaacg gacaggcctg cggtgtgatt gccatttttg ccgaacatgt cagccatttt       420
     atcaataatg aaaacatgtt cggcctctat tgccatgtca tgcagcaccg cctgaaaaag       480
     ttgcaggaac tcgagcaact gcgtgggcag ttacgtcaaa tccgtcaggt atttcaggtt       540
     cagcaacaga aagaaaaaca actggatgaa ctgcttgcct ccctgagtgg atcgaaaccc       600
     gcaggagtga gccgtatttc tgtggattac agccacatcg ataatctgcc aaaggccatc       660
     gaagaatttg aaagcgccgt gttggttcaa cgtcagcgtc agtatggcaa tgacacccga       720
     ctgattgccc aaagtctggg gattgccacg cgcacgttgg tttacaaact ggctaaatac       780
     gggtgtagat tatga                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page