(data stored in ACNUC1104 zone)

EMBL: FN667741.PE270

FN667741.PE270       Location/Qualifiers
FT   CDS_pept        282828..283493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0054"
FT                   /locus_tag="XBJ1_0274"
FT                   /product="conserved hypothetical protein (probable
FT                   component of the SST VI cluster)"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0274"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79425"
FT                   /db_xref="InterPro:IPR017738"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYP7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79425.1"
FT                   /translation="MNIVLIISSLLASLTGDPKLANLVEPKEVVAPKEEYTDEMQKCRF
FT                   EPSPLVRLACYDRTVNNLKFNALQIPMENMGLVWRQAMEQEMKRTDYSTGFIVTQGENG
FT                   EAPVILTTPAVGVPPPRPVLMLSCIDRITRLQVALPKPMGSGTVTVTTDKTQFKTEWFL
FT                   REHGYLWESSRGLPGIEEIKRLMNSDQMTITARTGSPITFNISQLEQAAKPLRDACRW"
     atgaatattg tattaattat cagctcattg ctcgcgtcat tgacgggtga tcccaaactg        60
     gcgaatctgg ttgagccaaa ggaagtggtc gcacccaaag aagaatacac ggacgaaatg       120
     caaaaatgcc gttttgaacc gtctccactt gtccggctgg cgtgctatga ccgtacggta       180
     aataacctga aatttaacgc cctgcaaatc ccgatggaaa acatggggct tgtgtggcga       240
     caggcgatgg agcaggaaat gaaacgcacc gattactcta ctggcttcat tgtgacgcag       300
     ggagaaaatg gtgaggcacc cgtgatcctg accacaccgg cggtgggggt tccgcctcct       360
     cgtccggtcc tgatgctgag ttgcattgac cgcatcaccc gtttgcaggt ggcgctgcct       420
     aaaccgatgg gatccggtac ggtcactgtg actacggaca aaacccaatt caaaaccgag       480
     tggttcctgc gggaacacgg ttacttatgg gaatccagcc gcggcttgcc gggcattgag       540
     gaaatcaagc gcttaatgaa cagcgatcag atgaccatca cggctcgcac tggcagcccg       600
     ataaccttta atatttctca gctggagcag gccgcgaaac ccttacgcga tgcctgccgt       660
     tggtaa                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page