(data stored in ACNUC1104 zone)

EMBL: FN667741.PE271

FN667741.PE271       Location/Qualifiers
FT   CDS_pept        283499..284935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0054"
FT                   /locus_tag="XBJ1_0275"
FT                   /product="Conserved hypothetical protein with ImpA
FT                   domain(probable component of SST VI cluster)"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0275"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79426"
FT                   /db_xref="InterPro:IPR010657"
FT                   /db_xref="InterPro:IPR017739"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYP8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79426.1"
FT                   /translation="MDIRTQFDWFGALLAPLSDEQTGKALSESDPAWEFIDGEMVKFGS
FT                   LSHGTLEVDALQRQALQLFSEHSKDFRLMVHLLRTLQHAGHPAELILAIELLTEYVKNY
FT                   WEKAWPVKPVLKRRLAQQVIKRFESAQSSFTDQASKSQRDEAQGALAHLAQCWHASEPD
FT                   LAKDVDQLRTRYNRQPEARTAPTQTAPTTPEAASVAPSPQSPEQAPMPEVAVNSSSDKA
FT                   WKQTLMTVADLLCERYPESPIGYSLRRHAVWHTITTAPMANATGKTPLAPASADRTADY
FT                   LARLPTADNKLLAQIEQSLALAPYWLDGHAIAAQAAEQRGYSRVAQAMRDELKAFLARL
FT                   PVLKTLSFSDLSPFISPDTLDWLTPEPDTSGSPGAASADQEAIWHCFQQQGLEAALQML
FT                   EEHQQSLTEPRDQFYGQLFTAQLLEEAGMTALAHQHYRNLLHTGQHMLLTEWEPSLLTL
FT                   LAEKIPSPAKDTASHRSVNT"
     atggacatca gaacacaatt cgactggttc ggcgccctgc tggcgcccct gtccgacgaa        60
     cagacgggca aggcactgag tgagagtgat cccgcctggg aattcatcga cggcgagatg       120
     gtcaaattcg gctcgctgtc acatggcacg ctggaagttg acgccctcca gcgacaggcc       180
     ttgcaacttt tcagcgagca cagcaaggac ttccggctga tggttcacct gctgcggact       240
     ttgcagcatg ccggccaccc tgccgagctg attctggcga tagagctgct gacagagtac       300
     gtaaaaaact actgggaaaa agcctggccg gtcaaaccgg tattgaagcg ccggctggca       360
     cagcaggtga tcaaacggtt tgaatcggcc cagtcgagct tcactgatca ggccagtaaa       420
     agccagcgcg acgaggcaca aggcgctctg gctcatctgg ctcagtgctg gcacgccagt       480
     gagcccgacc ttgcgaaaga cgtcgatcaa ctgcgtaccc gctataaccg ccagccagag       540
     gcacgaacgg cgccgacaca gacggcacct accacccctg aagcggcgtc ggtagctccg       600
     tcgcctcagt ctcctgaaca ggcgccgatg cctgaggtgg cggtcaacag ttccagtgat       660
     aaagcatgga aacaaaccct gatgacggtg gcggatctgc tgtgtgaacg gtatcccgaa       720
     tccccgattg gctatagcct gcgccgccat gcggtctggc acaccattac cacggcgccg       780
     atggcgaacg ccacaggcaa aacgccgctg gcgccggcgt cggcggatcg taccgccgat       840
     tatctggcgc gactgccgac ggcggataac aaattgctgg cgcaaattga gcagagctta       900
     gccctcgccc cttactggct ggacggccat gccattgccg cccaagcggc ggaacaacgc       960
     ggctacagcc gcgttgcgca ggccatgcgt gacgaactga aggcgttttt ggctcggctg      1020
     cctgtactga aaaccttaag tttttccgac ctgagtccgt ttatttctcc tgacactctg      1080
     gactggctca cgccggaacc cgacaccagc ggaagcccgg gagccgcgtc ggccgatcag      1140
     gaagccatct ggcactgctt ccagcagcaa gggctggaag ccgcccttca gatgctggaa      1200
     gaacaccagc agtcactgac ggagccccgg gatcaattct atggtcagtt gttcactgcc      1260
     caactgcttg aagaagcggg catgaccgca ctggcacacc agcattaccg gaacttgtta      1320
     cacacgggac aacacatgtt actcactgaa tgggaaccca gcctgctgac cctgctggct      1380
     gaaaaaatac cttcgcctgc gaaggatact gcgtcacaca ggagcgttaa cacatga         1437
//

If you have problems or comments...

PBIL Back to PBIL home page