(data stored in ACNUC1104 zone)

EMBL: FN667741.PE272

FN667741.PE272       Location/Qualifiers
FT   CDS_pept        284932..288501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0054"
FT                   /locus_tag="XBJ1_0276"
FT                   /product="Conserved Hypothetical protein (probable
FT                   component of SSt VI cluster)"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0276"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79427"
FT                   /db_xref="GOA:D3UYP9"
FT                   /db_xref="InterPro:IPR009612"
FT                   /db_xref="InterPro:IPR010623"
FT                   /db_xref="InterPro:IPR017731"
FT                   /db_xref="InterPro:IPR025743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYP9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79427.1"
FT                   /translation="MKWPSLSSLAPLKSALPALSKFKSLPRLKATMALALALIPCLLLI
FT                   AVWVWGPEWKLRNDTPLDSLAARWLATALIILMVLLWIGIKAWRRLRQLEKLNLDVELK
FT                   GVDPVRVDIEHQARYLDHWKAQLQRHLDSYNYLYQRPWYMMVGSQQSGKTTLIKEGYKL
FT                   SDIAAPEYLRQDGDIALRLRCWLGEKAVIIDPDGGLIDQPVPVNSDKPQINSRLWESLL
FT                   NWLTENRQRQPLNGIILTVDTLRLLTDNREQRDRYVREIHQRLQNLRLTFHSQLPLYLV
FT                   MTKIDLLHGFEAMYPSLDRRQRDQILGVTFSLNNRDEKAWHSELAQFWQQWMANLNGAM
FT                   PDMMLNGVDAGQRSALFSFTRQVQGLHSYIAQMLEDILYNDEHHRPMLRGVYLTSARQV
FT                   GQMDDLFTQSASAQYHLGSQAFPTWPAGDTLPYFTQSLFEEVLLAEPNLAAENRLWLSR
FT                   NRRQLYTFATISALVIAAMWGGWHYFYQKNYRAGEEVLAQAKNFLSVPPPDGDDRYGNL
FT                   QLPLLNPIRDATLAYGNYHEKKSFLTDMALYQGDGVGPYVEGTYLKLLEQRFLPSLMQG
FT                   LLDDLNRAPAGSEEKLEILRVMRMMEDGSKRNNGLVGQYMRARWSKAFHGQRDLQAQLL
FT                   THLDYALAHTDWKGQRDKDNQDALARFAPFIKPMKQAQQELSALTINQRVYQNLRLKAQ
FT                   DTLSAPVNLRDQIGPSFDSVFIAGNESRLVIPQFLTRHGLTDYFVRQDKELVELTEMDS
FT                   WVLNLPLKTNKYSDTDQGNIQREITELYVGDYTATWRAAMNNLEVRDFEDLPQAISAIE
FT                   QVISGEQPIKRALQILSDNTRPPELVSGLSDKEKQALLAQSDYRLLNRISRDFAPETGV
FT                   LVEHGDKGSALQSVYQKLMALHRYLLAIQNSPVPGKAALQAVQLRLDQNNSDAIFEVQQ
FT                   MAKNLPEPLNRWVGDLAEQAWRVVMMEAVRSLEVEWNESVVKQYKTYLAGRYPFNPAAT
FT                   EDVPLSEFDRFFRPDGTLDTFYKQSLKPFVENNLTTGTDGRELIRADVLKQLAMADRIR
FT                   TTFFTPQNGLGTAFAIEPVSLTGNKRRGLLNLDGQLVDYAHGRSNVAHLVWPNSMRAGT
FT                   ESRLTLMPDRSNAAPRSLSFTGPWAQLRLINSGKLTNVQPGAFDVRFAVDGGEITYRIY
FT                   VDESDNPFAGGLFSQFRLPDTLY"
     atgaaatggc cctctttgtc atccttggcg ccgttgaaat cagccttgcc ggcgctgtca        60
     aaatttaaat ccctgccgcg tctcaaggcc acgatggcgc tggctctggc ccttatcccc       120
     tgcctgctgc tgatcgcggt ctgggtgtgg gggccggaat ggaaactgcg caacgatacc       180
     ccgctggaca gtctggcggc gcgctggctg gcgaccgctc tcatcatcct gatggtgctg       240
     ctctggatcg gcatcaaagc gtggcgtcgc ctgcgccagc tggaaaaact caacctggac       300
     gtcgagctga aaggggttga tccggtgcgg gtcgatatcg agcaccaggc tcgttacctt       360
     gatcactgga aagcccagct acaacgccat ctggacagct ataactacct gtatcagcgt       420
     ccgtggtaca tgatggtcgg cagccagcag agcggcaaaa ccacgctgat caaggaaggc       480
     tataaactgt ccgacatcgc ggcgccggaa tacctgcgtc aggatggcga cattgcgctg       540
     cggctgcgct gctggctggg agagaaagcg gtcatcatcg atcccgatgg cggcctgatt       600
     gaccagccgg tgccggtcaa cagtgacaaa ccgcagatca acagccgcct gtgggaatcc       660
     ctgctgaact ggctgacgga aaaccgccag cgccagccgc ttaacggcat tattctgacc       720
     gtcgataccc tgcgcctgct gaccgacaac cgggagcaac gcgatcgcta cgtgcgggaa       780
     atccaccagc gcctgcaaaa cctccgtctg accttccaca gccagctgcc gctctatctg       840
     gtcatgacca aaatagacct gctgcacggc ttcgaagcga tgtacccgtc gctggatcgc       900
     cggcagcgtg accagatcct cggcgtgact ttcagcctca ataaccggga tgaaaaagcc       960
     tggcacagcg agctggcgca gttctggcag cagtggatgg ccaacctcaa cggggcgatg      1020
     ccggacatga tgctcaacgg cgtcgatgcc ggccagcgca gcgctctgtt cagctttacc      1080
     cggcaggtgc aggggctgca cagctatatc gcgcagatgc tggaagacat cctgtacaac      1140
     gatgaacacc accgcccgat gctgcgcggt gtctacctga cctccgcccg tcaggtcggc      1200
     cagatggatg acttgttcac ccagtccgcc tcagcccagt atcacctcgg ctcgcaggcg      1260
     ttcccgacct ggccggcggg cgataccctg ccgtatttta cccagtccct gtttgaggaa      1320
     gtgctgctgg ctgagccgaa cctcgccgcg gaaaaccgcc tctggctgag ccgcaaccgc      1380
     cgccagctgt acaccttcgc cacgatcagt gccttagtca tcgcggccat gtggggcggc      1440
     tggcattatt tctaccagaa aaactaccgg gccggggaag aagtgctggc gcaggcgaaa      1500
     aacttcctgt ccgtgccgcc gccggacggg gatgaccgtt acggcaacct ccagctgccg      1560
     ctgctgaacc cgatccggga tgccactctg gcctacggca actaccacga gaaaaaatcc      1620
     ttcctgaccg acatggcgct gtatcagggg gacggggtcg ggccgtatgt ggaaggcacc      1680
     tacctgaaac tgctggagca gcgtttcctg ccgtcgctga tgcaggggct gctggacgac      1740
     ctgaatcggg cgccggccgg cagtgaggaa aaactcgaga tcctgcgggt gatgcgcatg      1800
     atggaagacg gcagcaagcg taacaacggc ttggtcgggc agtacatgcg ggcgcgctgg      1860
     agcaaggcgt tccacggcca gcgggattta caggcgcagc tgctgaccca tctggattac      1920
     gctctggccc ataccgactg gaaggggcag cgcgacaagg acaatcagga tgccctcgcc      1980
     cgctttgcgc cgtttattaa gccgatgaag caggcccagc aggagctgag tgccctgacc      2040
     atcaaccagc gggtttacca gaacctgcgc ctgaaggccc aggataccct gtccgccccg      2100
     gttaacctgc gtgaccagat tgggccgagt tttgacagcg tgtttattgc cggcaacgaa      2160
     agccggctgg tgatcccgca gttcctgacc cgccacggcc tgacggatta ctttgtccgg      2220
     caggacaagg agctggtcga actgaccgag atggacagct gggtgctgaa cctgccgctg      2280
     aaaaccaata agtacagcga caccgatcag gggaatatcc agcgtgagat caccgaactg      2340
     tatgtcgggg attataccgc gacctggcgg gcggcgatga acaatctgga agtgcgggac      2400
     tttgaggatc tgccgcaggc catcagcgcc atcgagcagg tgatcagcgg cgaacagccg      2460
     atcaagcgcg cgctgcaaat cctcagtgac aacacccggc cgccggagct ggtgagtggg      2520
     ctgagcgaca aggaaaaaca ggcgctgctg gcgcagtcgg attaccggct gttaaaccgc      2580
     atcagccggg actttgcgcc ggaaaccggg gtgctggttg agcacggcga caagggcagt      2640
     gccctgcaaa gcgtttacca gaaactgatg gcactgcacc gttacctgct ggctatccag      2700
     aactcgccgg tgccgggcaa ggcggcattg caggcggtgc agctgcggct ggaccagaac      2760
     aacagcgacg cgatatttga agtgcagcag atggcgaaaa acctgccgga gccgctgaac      2820
     cgctgggtcg gtgatctggc cgagcaggcg tggcgggtgg tgatgatgga agcggtgcgc      2880
     tcgctggaag tggaatggaa tgagtcggtg gtcaaacagt ataaaaccta cctggccggc      2940
     cggtatccgt tcaacccggc ggccaccgaa gacgtaccgc tgagtgagtt tgaccgtttc      3000
     ttccggccgg acggcacgct ggataccttc tataagcaga gcctgaaacc gttcgtggaa      3060
     aacaacctga ccaccggcac cgacgggcgt gagcttatcc gggcggatgt gctgaaacag      3120
     ctggcgatgg cggaccgtat ccgcaccacc ttcttcaccc cgcagaacgg gctgggcacg      3180
     gcgtttgcca tcgagccggt gagcctgacc ggcaacaaac gccgcggtct gctgaacctc      3240
     gacggccagc tggtggatta cgcgcacggg cgcagcaacg tggcgcatct ggtgtggccg      3300
     aactcgatgc gggcgggcac ggaaagccgg ctgaccctga tgccggaccg gagcaacgcg      3360
     gcgccgcgca gcctgagctt caccggcccg tgggcgcagc tgcggctgat taacagcggc      3420
     aagctgacca acgtgcagcc gggggcgttt gacgtgcgct tcgcggtaga cggcggcgag      3480
     ataacctacc gcatttacgt ggacgaatcg gacaacccgt ttgcgggcgg cctgttcagc      3540
     cagttcagac tgccggacac cctctactga                                       3570
//

If you have problems or comments...

PBIL Back to PBIL home page