(data stored in ACNUC1104 zone)

EMBL: FN667741.PE274

FN667741.PE274       Location/Qualifiers
FT   CDS_pept        289991..293062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0055"
FT                   /locus_tag="XBJ1_0278"
FT                   /product="Putative Rhs accessory genetic element (modular
FT                   protein)"
FT                   /EC_number="3.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0278"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79429"
FT                   /db_xref="GOA:D3UYQ1"
FT                   /db_xref="InterPro:IPR002196"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR033907"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYQ1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79429.1"
FT                   /translation="MSMKKNMAKLKKGRALIQQGQQAAQLAKHVTGKLGGGLGGAAAGT
FT                   AGLIPGGGFGGGIGGGSAGTGAAGLIPGGGFGGGLGGAGGGAGQGLAARAASGQSGAAK
FT                   ALQKAGQLLGGGGGMAPSGLQFTLTAGGLPPETFVVTDFALTEGFSRPFSLHVGLASAD
FT                   PAIDFPAVLDRSATLTILQEGVEQRSITGIVARFEQGNTGLHQTTYQMSLYPDLWRTTL
FT                   RQNSRIFQQLDIAAILTTLLKEHGIRDVVFSLRHPHPAREFCVQYQESDFAFLQRLTAE
FT                   EGIFYFFECGNGRNTLVFADDAGSVPPGIVLAYQPGEGSTTGTPSVGSFTCSAQVRPAQ
FT                   VQLKDYTFKNPAWPAEFSQQMKEDTLQQMYYEHYDYPGRFKDEAHGQAFTRYRLEALRS
FT                   DAVTGQASGQAIAVQPGKLFTLFNHPREDLNQPWQVVGASHTGSQPQARETASSDSGTT
FT                   LHSQFSFIRHNQHWRPAPLPKPTIDGPQIAKVVGPAGEEIFCDQYGRIRLQFPWDRYGK
FT                   SDDQSSCWIRVSQPWAGQGWGMLAIPRIGQEVVVDFLHGDPDQPIVTGRTYHASNIPPG
FT                   ALPGSKTQMAFRSKTHKGEGYNELLFEDAKGSERLALHAQKDMHTTVKDNQSLVVEAGD
FT                   RTLTVQTGDEHKTVKQGNLTETICQTRSTEANVIQVKAKAGKAGLGTQLYQAEDNITLQ
FT                   VGKGSIEMTPEHIRVAFGSSVILLNSSGVFVDGPAIGLNNGSAGAGLPPAAADGGDSAS
FT                   ESGSLLPAAVMAAGLGPMGMAALGSMGLISSASAATPASAPRPMPTPADGAGRQAAPAD
FT                   SQATPASAPRSMPVPVNGAGRQAVPAGSQVAAPSAPPVSATNLTTSTKKTMGQDGLDLL
FT                   KGIESLRLKPYDDQTGKTVTKWTKGATIGYGKLIEKKDWDTYKDGITEDEAEELFKKTL
FT                   APFEKTVNDGITKEINQNQFDALTMFAYNIGAKGFNDSSVLKLVNDENAKTDYDTLDDA
FT                   WKAWNKSQGKVNQGVINRRAAELKIYNEGVYERW"
     atgtcgatga aaaagaatat ggcaaaactg aagaaagggc gggcgctgat ccagcaggga        60
     cagcaggccg cccagctggc aaaacacgtc actggtaagc tggggggcgg ccttggcggc       120
     gcagccgcag gcaccgccgg cttaattccg ggcggcggct ttggcggggg tatcgggggc       180
     ggctcagcag gcaccggcgc ggcgggctta atcccgggcg gtggctttgg cggcggattg       240
     ggtggtgccg gggggggagc cgggcaggga ctggccgcgc gggcggcgag tggtcagagc       300
     ggggcggcca aggcgctgca aaaagccggc cagttattgg gcggcggggg gggcatggcc       360
     ccgagcgggc tgcagtttac cctgacggcg ggcggcctgc cgccggaaac ctttgtcgtg       420
     acggacttcg ccctgacgga aggcttttcc cggccgttca gcctgcatgt cgggctggcg       480
     agtgccgacc cggcgattga ctttccggcg gtgctcgacc gcagcgcgac cctgaccatt       540
     ctgcaggagg gggtggagca gcgcagtatc accgggatag tggcgcgttt cgagcagggc       600
     aacaccggct tgcaccagac cacctaccag atgagcctct acccggattt gtggcgcacc       660
     accctgcggc agaactcgcg tatcttccag cagctggaca tcgccgctat cctcaccacg       720
     cttttgaaag agcacggtat ccgcgacgtg gtgttcagcc tgcgccatcc gcatccggcg       780
     cgggaattct gcgtgcaata tcaggaaagc gactttgcct tcctccagcg gctgaccgcg       840
     gaagagggca tcttttattt cttcgaatgc ggtaacggcc gtaacacgct ggtgtttgcc       900
     gatgacgccg gctccgtgcc gccgggcatt gtgctggcgt accagccggg ggaaggcagc       960
     acgacgggca caccgtcggt gggcagcttt acctgcagtg cgcaggtgcg cccggcacag      1020
     gtgcagctca aggactacac cttcaaaaac ccggcgtggc cggcagaatt cagccagcag      1080
     atgaaggaag acaccttaca gcagatgtac tacgagcact acgactaccc ggggcggttt      1140
     aaggacgaag cccacggcca ggccttcacc cgctaccggc tggaagcgct gcgcagtgac      1200
     gcggtgacgg gacaggccag cgggcaggcc attgccgtgc aaccgggcaa attatttacc      1260
     ctgtttaacc acccgcgtga agacctgaac cagccgtggc aggtggtggg cgcgagccac      1320
     accggcagcc agccgcaggc gcgggaaacc gccagcagcg acagcggcac cacgctgcac      1380
     agccagttca gcttcatccg ccacaaccag cactggcggc cggccccgtt gccgaaaccg      1440
     accattgacg gcccgcagat tgccaaggtg gtggggccgg ccggggaaga aatcttctgt      1500
     gaccagtacg ggcgcatccg gctgcagttc ccgtgggacc gatacggaaa aagcgacgac      1560
     cagagttcgt gctggatacg ggtgagccag ccgtgggccg ggcagggctg gggcatgctg      1620
     gcgattccgc gcatcggtca ggaagtggtg gtggacttcc tgcacggcga cccggaccag      1680
     ccgattgtga ccggcagaac gtatcacgcc agtaacatcc caccgggcgc gctgccgggc      1740
     agcaagaccc agatggcgtt ccgctccaag acccacaagg gggaggggta taacgaactg      1800
     ctgtttgagg atgcgaaggg cagtgaaagg ctggcgctgc atgcgcagaa ggacatgcac      1860
     accacggtga aagataacca gagcctggtg gtggaggcgg gtgaccgcac gctgactgtc      1920
     cagacggggg atgagcacaa aaccgttaaa cagggcaatc tgacggagac catctgccaa      1980
     acccgcagca ccgaggccaa cgtgatacag gtgaaggcga aggcgggcaa agcggggctg      2040
     ggaacgcagc tgtatcaggc tgaggataat atcactctgc aggtgggtaa gggtagcatc      2100
     gagatgacac cggagcatat ccgggtggca tttggctcat cggttatcct gctgaacagc      2160
     agcggagtct ttgtggatgg cccggctatt gggttgaaca acggcagtgc aggagcggga      2220
     ctgccgccgg ccgccgcaga cgggggtgac agtgcttcgg agagtggaag tttgcttccg      2280
     gcagcggtga tggcggcggg tctgggaccg atggggatgg cggctctggg atcgatgggg      2340
     ctgatttctt ccgcgtcggc ggcaacgcca gcatcagcac caagacctat gcccactccc      2400
     gccgatgggg cagggagaca ggcagcacct gctgactctc aggcaacgcc agcatccgct      2460
     ccaagatcta tgcctgttcc agtcaatggg gcagggcgac aagcagtacc tgctggttct      2520
     caggtagcgg caccatcagc accccctgta tctgcaacta atttaaccac cagcacgaaa      2580
     aagaccatgg gacaagatgg actggattta ttaaaaggta tcgagtcatt gagattaaaa      2640
     ccttatgatg accagacagg gaaaaccgtc accaaatgga ctaaaggcgc tacaattggc      2700
     tatggtaaat taattgagaa gaaagactgg gatacctata aagacggtat taccgaagat      2760
     gaggctgagg agttatttaa aaagacactg gcaccttttg agaaaaccgt taatgacgga      2820
     attacaaaag agataaacca gaatcagttt gatgccttaa ccatgtttgc atataacatt      2880
     ggtgcaaaag gattcaatga ttcatctgtt ctaaaactgg taaatgatga aaatgccaaa      2940
     accgactatg acacgctgga tgatgcctgg aaggcttgga ataaatcgca aggcaaagtt      3000
     aatcagggcg taataaacag acgcgcagct gagttaaaaa tctataacga aggagtttat      3060
     gaaagatggt aa                                                          3072
//

If you have problems or comments...

PBIL Back to PBIL home page