(data stored in ACNUC1104 zone)

EMBL: FN667741.PE278

FN667741.PE278       Location/Qualifiers
FT   CDS_pept        298712..299164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0056"
FT                   /locus_tag="XBJ1_0282"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0282"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79433"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYQ5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79433.1"
FT                   /translation="MITIFIMNSKLEEKMLLARAKRYINNIQGIEKISISLSNNDKEFQ
FT                   WHKEIINSILKGKEIPECKLELPVSEEDIYSYLQSKIHIGECNSYYMFFEGMVKFSFNI
FT                   IDLKRFLSSCYALKKTFDLYVLLLNPMKVIAISEEEYELSFYNKTM"
     atgatcacca tatttattat gaatagtaaa ttagaagaaa aaatgctctt ggcaagagca        60
     aagaggtata tcaataacat tcaagggatt gaaaagatat ctatatcttt aagtaataat       120
     gataaggaat ttcagtggca taaagagata atcaatagta ttttaaaagg aaaagaaata       180
     cctgaatgca agctagaact tcctgtatct gaggaggata tttactcata tctgcaatct       240
     aaaatacata ttggtgaatg taatagttac tacatgtttt ttgaaggaat ggtaaagttt       300
     tctttcaata ttattgattt aaagagattt ttatctagct gctatgcatt aaagaaaact       360
     tttgatttgt atgttttatt actaaatcca atgaaagtta ttgcaataag tgaagaagaa       420
     tacgagttaa gtttttacaa taagactatg taa                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page