(data stored in ACNUC1104 zone)

EMBL: FN667741.PE287

FN667741.PE287       Location/Qualifiers
FT   CDS_pept        302799..303326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0059"
FT                   /locus_tag="XBJ1_0291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0291"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79442"
FT                   /db_xref="InterPro:IPR037883"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYR4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79442.1"
FT                   /translation="MSIESLNNILPLPIHPNENGQNRKWSLIDERHAFPKDYIDFITQY
FT                   GTGRIADFITIFNPFSEDDDLNFFRQKEWIIEDFNSLVESDPDYYPFILYPKKDGLLPI
FT                   GVTDNGDYIFWVVSSDDSELWKVAIIAARAPEVEYRQENFTDFLEGVLSRKIKCMSFPD
FT                   GFPPNSIEFDRI"
     atgagtatcg agagtttaaa taatatattg cccttaccta tccatccaaa tgaaaatggt        60
     cagaacagaa aatggtcgtt gatagatgag cggcacgctt ttcctaaaga ttatattgat       120
     tttatcactc aatatggcac gggcagaatt gccgatttta tcactatatt taacccattt       180
     agcgaagatg atgatctgaa ttttttcagg cagaaggaat ggattattga ggattttaat       240
     tctcttgttg aatctgatcc ggattactat ccgtttattc tttatcctaa aaaagatgga       300
     ttgcttccca taggcgttac tgataacggt gactatatct tttgggttgt atcatcagat       360
     gacagtgaat tatggaaggt agccattatt gctgcaaggg caccagaagt tgaatataga       420
     caagaaaact tcactgattt tttagaaggt gttttatcca gaaagatcaa gtgcatgtca       480
     tttcctgacg gttttccacc taacagtata gaatttgaca gaatttaa                    528
//

If you have problems or comments...

PBIL Back to PBIL home page