(data stored in ACNUC1104 zone)

EMBL: FN667741.PE289

FN667741.PE289       Location/Qualifiers
FT   CDS_pept        304439..305026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0060"
FT                   /locus_tag="XBJ1_0293"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0293"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79444"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYR6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79444.1"
FT                   /translation="MEKSLKLINNNFSLSEFNFSGFSSSVNWVGFFERKHDFSYHLIDE
FT                   SIELFSDFFEGKHASPTIITALSFDDDKEDDIETIARYQEIYHSVKEKNLLLPMTESYE
FT                   NYLYGETLLPAHSLSFSFTKNDFIDLSKLIMCHAGVIGQVCFYINPALNIGVYPHEDTG
FT                   FGCIALNGEKNTCIDFLTYCKKNENFNVVIDN"
     atggaaaaat cattaaaatt gataaataat aatttttcac taagtgaatt taattttagt        60
     ggattcagtt catctgtaaa ttgggttggt tttttcgaaa gaaaacatga tttctcttat       120
     caccttattg atgaatccat tgagttattt tctgatttct ttgaaggaaa acatgctagt       180
     ccgacaatca ttactgccct ttcgtttgac gatgataaag aagatgacat agagacaatt       240
     gcgagatatc aagaaattta ccatagcgtc aaagaaaaaa acttattact tccgatgaca       300
     gaaagctatg aaaattattt gtatggagaa acattattac cagcacattc attaagtttt       360
     agttttacaa aaaatgattt tatcgatctt tcaaaactta ttatgtgtca tgcgggggta       420
     ataggtcagg tttgttttta cataaaccct gccctcaata taggtgttta tcctcatgaa       480
     gatactggct ttggttgcat cgcactcaat ggagaaaaga atacatgcat tgatttttta       540
     acttattgta aaaaaaatga aaatttcaat gttgttatag ataattaa                    588
//

If you have problems or comments...

PBIL Back to PBIL home page