(data stored in ACNUC1104 zone)

EMBL: FN667741.PE292

FN667741.PE292       Location/Qualifiers
FT   CDS_pept        305890..306267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0296"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0296"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79447"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYR9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79447.1"
FT                   /translation="MGWRAKIAISSLNYLHQTQYLSVRGEYEEIITGKGTPRVHKDTGI
FT                   QKNLEDRKGKTNKFWIGAKEWQVVHSGKGLDPHHRILEQTLPNGQKIYGYVLNHDYEKV
FT                   YKFPSPWYPDGGKYPGHKSMK"
     ttgggttggc gggcaaagat tgcgataagt tcactaaatt atcttcacca aacccagtac        60
     ctaagcgtta ggggagaata tgaagagata atcacaggaa aaggtactcc aagggtacat       120
     aaagatactg gaattcaaaa aaacctagaa gatagaaaag gaaaaacgaa taaattctgg       180
     atcggagcta aagaatggca agtagttcat tcaggaaaag ggcttgaccc acaccatcgc       240
     atactagaac aaacattacc gaatggtcaa aaaatatatg gatatgtatt aaatcatgat       300
     tacgaaaaag tctataaatt tccgagtcct tggtaccccg atggtggtaa atatccaggg       360
     cacaagtcaa tgaaatga                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page