(data stored in ACNUC1104 zone)

EMBL: FN667741.PE293

FN667741.PE293       Location/Qualifiers
FT   CDS_pept        complement(306077..306388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0297"
FT                   /product="hypothetical protein; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0297"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79448"
FT                   /db_xref="GOA:D3UYS0"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYS0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79448.1"
FT                   /translation="MITQVKKVNIIGYSAFYIINIYAIFTVDHSIAILLNNLMFIISLT
FT                   CALDIYHHRGTKDSEIYRLFRNHDLIHIHIFFDHSVMFVLVCDGVGQALFLNELLAIL"
     atgattactc aggtgaaaaa agtcaatatc atcggctata gcgcattcta catcattaat        60
     atatatgcaa tatttactgt ggatcatagt attgccattc tgttgaataa tttaatgttt       120
     atcatttcat tgacttgtgc cctggatatt taccaccatc ggggtaccaa ggactcggaa       180
     atttatagac tttttcgtaa tcatgattta atacatatcc atatattttt tgaccattcg       240
     gtaatgtttg ttctagtatg cgatggtgtg ggtcaagccc ttttcctgaa tgaactactt       300
     gccattcttt ag                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page