(data stored in ACNUC1104 zone)

EMBL: FN667741.PE296

FN667741.PE296       Location/Qualifiers
FT   CDS_pept        307576..307998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0061"
FT                   /locus_tag="XBJ1_0300"
FT                   /product="Insertion element IS1 1/5/6 protein insB"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0300"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79451"
FT                   /db_xref="GOA:D3UYS3"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYS3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79451.1"
FT                   /translation="MTTLPLDGDDIHLICEVDEQESFVGSQKNQRWLWYAWEPRMKRIV
FT                   AHTFGDHSRKTWEKLLALLSPFNIRFYCTDDYAVYDCLPEEVHLTGKIFTQRIERTNLT
FT                   HRTRIKRLNRKTIGYSKSEEMHDKVIGTFIERENYI"
     gtgacgacgc ttcctcttga cggggatgac attcatctta tctgtgaagt ggatgagcag        60
     gagtcgtttg tggggagtca gaaaaatcag cgctggctct ggtatgcctg ggagccgcgt       120
     atgaaacgga tagtggcaca tacttttggg gatcacagca gaaaaacatg ggaaaaacta       180
     ctggcactct tgtcaccctt taatatccgg ttttactgta cggatgatta tgccgtttat       240
     gattgtcttc ctgaagaagt ccatcttact ggaaagatat ttacccaacg tatagagaga       300
     accaacctta cccatcgtac ccgaataaaa aggctgaata gaaaaacaat cggttattcc       360
     aaatctgaag aaatgcacga taaagtgata ggcactttca ttgagcgtga aaactatatt       420
     tag                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page