(data stored in ACNUC1104 zone)

EMBL: FN667741.PE298

FN667741.PE298       Location/Qualifiers
FT   CDS_pept        308598..308885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0062"
FT                   /locus_tag="XBJ1_0302"
FT                   /product="Rhs element Vgr protein (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0302"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79453"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYS5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79453.1"
FT                   /translation="MIFQIYSFLRAAHTLTVGGVMNTAVALSQSEQVGVHKSVIVGNTL
FT                   SIKAGDVIELQCGASTLRMDSSGKITLIGTEFKFEASGPVQITGKDIDLN"
     atgatcttcc agatttattc ttttttaaga gcggctcaca ccctgaccgt cggcggagtc        60
     atgaatacgg ccgtcgcctt aagccagagc gaacaggtgg gcgtccataa gtcggttatc       120
     gtcggtaaca ccctgtccat caaggccggg gatgtgattg agctgcaatg cggtgccagt       180
     accctgcgca tggacagcag cggcaaaatt acccttattg gcaccgagtt taagttcgag       240
     gcgagtggcc cggtacaaat caccggcaaa gacatcgacc tgaactaa                    288
//

If you have problems or comments...

PBIL Back to PBIL home page