(data stored in ACNUC1104 zone)

EMBL: FN667741.PE301

FN667741.PE301       Location/Qualifiers
FT   CDS_pept        309983..310288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0062"
FT                   /locus_tag="XBJ1_0305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0305"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79456"
FT                   /db_xref="InterPro:IPR025425"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYS8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79456.1"
FT                   /translation="MADNYIVRTAGEWLIVGLLPDVCKTPMGASTPPIPYPVVAKLADS
FT                   SAPEMLWKAFVIQGLKLISLLGSQLSVLSGLFMHIRLLCGRKMRVTTGVKCPRHVS"
     atggctgata actacatcgt ccggacggcc ggtgaatggc tgatcgtcgg cctgttgccg        60
     gatgtgtgta aaactccgat gggcgcatca accccgccga tcccctatcc ggtggtcgcc       120
     aaactggccg acagttccgc accggaaatg ttgtggaaag cctttgttat acagggcttg       180
     aagctgatat ctttgctcgg gagtcaactg tcggtactgt ctggtttgtt tatgcatatc       240
     aggctactat gcggcaggaa aatgagggta acaacgggtg taaaatgtcc acgtcacgtc       300
     agttag                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page