(data stored in ACNUC1104 zone)

EMBL: FN667741.PE302

FN667741.PE302       Location/Qualifiers
FT   CDS_pept        310135..310380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0306"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0306"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79457"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYS9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79457.1"
FT                   /translation="MESLCYTGLEADIFARESTVGTVWFVYAYQATMRQENEGNNGCKM
FT                   STSRQLACILNVWYWVVCKELAIFSKQVHNGAHLGT"
     gtggaaagcc tttgttatac agggcttgaa gctgatatct ttgctcggga gtcaactgtc        60
     ggtactgtct ggtttgttta tgcatatcag gctactatgc ggcaggaaaa tgagggtaac       120
     aacgggtgta aaatgtccac gtcacgtcag ttagcatgta ttttgaacgt ttggtattgg       180
     gttgtgtgca aagagcttgc catcttctcc aaacaagttc ataatggcgc ccatcttggt       240
     acgtaa                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page