(data stored in ACNUC1104 zone)

EMBL: FN667741.PE330

FN667741.PE330       Location/Qualifiers
FT   CDS_pept        complement(344364..344906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0335"
FT                   /product="Protein ytfJ precursor"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0335"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79485"
FT                   /db_xref="InterPro:IPR006513"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYV7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79485.1"
FT                   /translation="MLYAILSLTSVFASAHNIAVGQPVPTVSVTDKGELLLNNDKFSYQ
FT                   NWNSTELPGKVRTIQHIAGRSSAKEMNDPLIQALKQADLPKEKYQTTSIVNTDDAIFGT
FT                   SVFVRNSLEDSKKEFPWSQFIVDSEGLAKKAWGLEPKSSAIIVLDKNGNVKFVKDGKLS
FT                   NEDITHVLNLIKEELNN"
     atgttatatg caatactgag cttaacttca gtattcgcat ctgcccataa catcgcagta        60
     ggacagccag tccctacggt cagcgtgaca gataaaggtg agttactgct caacaatgac       120
     aagttcagct accaaaattg gaacagtaca gaacttcctg gaaaagtaag aaccatccag       180
     catattgctg gccgcagttc tgcaaaagag atgaatgatc ctctgattca agcgttgaaa       240
     caagccgacc ttccaaagga aaaatatcaa acaaccagca tcgtgaatac tgatgatgct       300
     atttttggta ccagcgtctt cgttcgtaat agtctcgaag acagtaaaaa agagtttccg       360
     tggtcacagt ttattgtcga tagtgaaggt ttagctaaga aagcctgggg tctggaaccc       420
     aaaagttcgg caatcatcgt gttggataaa aacggtaacg tgaaatttgt taaagatggt       480
     aaattgagca acgaagacat cacccatgtt ctcaatctga tcaaagaaga attgaacaac       540
     taa                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page