(data stored in ACNUC1104 zone)

EMBL: FN667741.PE332

FN667741.PE332       Location/Qualifiers
FT   CDS_pept        345243..345449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0337"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0337"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79487"
FT                   /db_xref="InterPro:IPR009491"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYV9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79487.1"
FT                   /translation="MKIFHHYNPLKVALYVKTLFRGRLYIKDMGAFEFNYGKILPPKIK
FT                   DKRHLNVMSEINQQVLRLQAEMG"
     atgaaaatct ttcaccatta taacccactg aaagttgctc tttacgtaaa aactctattt        60
     cgtgggcgtt tgtatattaa ggacatgggc gcttttgaat ttaactacgg gaagatcttg       120
     ccacccaaga taaaagataa acgtcacttg aatgtaatga gtgaaattaa tcagcaggtg       180
     ttgcgcctac aggccgaaat ggggtag                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page