(data stored in ACNUC1104 zone)

EMBL: FN667741.PE337

FN667741.PE337       Location/Qualifiers
FT   CDS_pept        349583..353326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0069"
FT                   /locus_tag="XBJ1_0342"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0342"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79492"
FT                   /db_xref="GOA:D3UYW4"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYW4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79492.1"
FT                   /translation="MTFLLLVGLLLITIVGLVGTQTGLHFMINSAARWVPGLDIANVSG
FT                   GWRDLTLKGVKYQMPGVSVSADNLYLSLRLSCLKHSHLCVNALTTEGVAVSVNTADLPP
FT                   SEKSPASEPLTELKTPYPISLDLLSLKNIHVKVDDIVIALDEFKTGAQWREKQLTLKPT
FT                   KISNLLVALPKTRPEQSGTVQKGKQKPEPEKSLGETLKALFAKPFLAELPNVPIPLDIM
FT                   AENIHGSQLRLTGDTDITINDLRLQASNQGQQVDVKTFSVSAPEGSLSLQGTAGLSEQW
FT                   PVKLVIKSNTNLNELKGQKLDLTLNGALLQQLNLALHLSGPIIANLSAQTELAKAGLPV
FT                   RLTLESKQLQWPLTGEPEYRLDGVKLRLNGKASGYDLSLRSDIKGRDIPPALLMLDAKG
FT                   NEELLRLTRLRLSALQGKAEITGIVDWSKAISWNANLILDGINTAKQWPEWPAKMNGKM
FT                   AIRGSLYGGSWQLQIPEIALDGYVKQNIVKAHGKASGNAAGQWNIPQFDLTFGRNRLNV
FT                   QGQLTDEKWKLDGEINAPQLNGLLPGLSGVVIGNVKLRGNMKAPQIVADLNARNVRWQN
FT                   DLKVDSATIKGDVRSAEQIEGQLSVAVHQLKQADLIINNLMLNAKGTEKQHDLHLNIEG
FT                   NPVSGQLALSGRFDRSQERWQGTINNTYFDTPVGEWRLNKAMVIDYLNPQQKVTIGTHC
FT                   WLNPNAQICVPKPIEAGASGHAEVVLKRFDLAMIQPFLDKMTQVKGVFSGNANVKWTAG
FT                   QALPQAKVVLQGNGVQLHQMVEGAALPVDFETLTVNAGLTNGKANVAWLFKLAGNGQLN
FT                   GNVQVDDLEGRRKLSGNVDIRALSLKLIKPILGKDEKAEGGLNANLRFGGNVKNPLLFG
FT                   QLKTDDLQIVSHWLPFDITQGQLAIYFDGVRSGLEGVIKTPKGQLNLNGNADWRNLNAW
FT                   YAKIAANGEKLRVTVPPMVKIDVSPNLVLEATPDLLKLDGNVDIPWARITVQELPESAV
FT                   GISSDEVMLDKNLQPIEKKKSSILVKSNLNIRIGDDVRLNAFGLKAQLKGVLKVIQDKQ
FT                   GLGLNGQIDIPDGRFHAYGQDLLVRKGTIIFSGPPEQPMLNIEAIRNPDSTANKVVAGV
FT                   KVTGLADKPKVEIFSEPAKSQQEALSYLLRGEGLEKSGSDNNQMTSMLIGLGVSQSGQL
FT                   VGKIGETFGVSDLALDTQGVGDKSQVVVSGKITNNLQVKYGVGIFDSLATLTLRYRVMP
FT                   RLYLDAVSGIDQALDLLYEFEF"
     atgacttttc tgctgcttgt tggcctgctg ctgataacca ttgtgggatt ggttggcaca        60
     caaaccggac tgcattttat gattaacagc gcagcacgtt gggttcccgg actggatatc       120
     gccaatgtca gcggaggatg gcgtgattta accttaaaag gtgttaaata tcagatgccg       180
     ggagtgagtg ttagtgctga caatttatac ctttcgctac gtttatcctg cttgaaacac       240
     agtcacctgt gtgtcaatgc gttaactacg gaaggcgtgg cagtctcggt gaatacggct       300
     gatcttcctc catcagaaaa gtcgcctgca tcagagccat tgactgaatt gaaaacaccg       360
     tatcctattt cactggattt gctttctttg aagaatatcc acgtcaaggt tgacgatata       420
     gtgattgcgt tggatgaatt taaaacaggg gcgcagtggc gggaaaaaca gctgacattg       480
     aaaccaacga aaatcagcaa tctattggtt gctctgccta aaacgcggcc tgaacaaagc       540
     ggtacagtgc aaaagggcaa acaaaagcct gaacctgaaa aatcattggg tgaaaccttg       600
     aaagcgctat ttgccaaacc tttcttagct gaattgccca atgttcctat tcctctcgat       660
     attatggcag aaaacattca tggcagtcag cttcgcctga caggtgatac agatatcacg       720
     attaatgatc tacggttgca agccagtaat cagggacagc aggttgatgt gaaaaccttc       780
     agtgtaagtg caccggaagg ctcactttcg ctacagggga cggcggggct atctgaacag       840
     tggccagtca aactggtgat taagagcaat acgaatctga atgaactaaa aggacaaaag       900
     cttgatttaa ccctgaatgg tgctctgttg cagcagctta atctggcatt gcatctttca       960
     ggacctatta ttgccaatct gagtgctcag actgagttgg cgaaggcggg tttgcctgta      1020
     cgcctgacat tggaaagcaa acaacttcag tggccattga cgggtgaacc ggaatatcga      1080
     cttgatggtg ttaagcttcg actgaatggc aaagccagtg gctacgatct ctccctccgt      1140
     tcagatatta aaggtcgtga tattcctcct gcattactaa tgttggatgc gaagggtaat      1200
     gaagaattgc tcaggctaac ccgtctgcgt ctgtctgcat tgcaggggaa agcggagatc      1260
     actggcatcg ttgactggag caaagcgatt agctggaatg cgaacctgat tctggatggc      1320
     atcaataccg ctaaacaatg gccagagtgg ccagccaaaa tgaatggcaa aatggcaata      1380
     cgcggtagct tgtatggcgg cagttggcaa ctccagatcc ctgaaattgc tcttgatggt      1440
     tatgtgaaac agaatatcgt caaagcacat ggcaaggcgt ctggcaatgc ggcgggacaa      1500
     tggaatattc ctcagtttga cctcactttt ggccgtaata ggctgaatgt tcaagggcag      1560
     cttacagatg aaaagtggaa gttggatggt gaaattaatg cgccacagtt aaatggatta      1620
     ctgccaggat tgtccggtgt ggttatcggt aatgtgaaac tgcgcggtaa catgaaagca      1680
     ccacaaatag tggcagattt aaatgcacgt aatgtgcggt ggcagaatga tctgaaagtg      1740
     gatagcgcca cgattaaggg agatgtgcgc tcggctgaac agattgaagg acagctctca      1800
     gttgctgttc atcaattgaa acaggcggat ttaatcatca ataatttgat gctaaatgct      1860
     aagggcacgg aaaagcagca tgatttacat ttgaacattg agggcaaccc cgtatcaggt      1920
     caattggcac tcagtggtcg ctttgaccgc agtcaggaac gctggcaagg aactatcaac      1980
     aatacctact ttgatactcc tgtcggtgag tggcgcctaa ataaggcgat ggtcattgat      2040
     tacctgaatc cacagcagaa agtaacaata ggaacacatt gctggcttaa cccgaatgca      2100
     cagatctgtg ttcccaaacc gattgaggcg ggagccagtg gccatgctga agtggtgctt      2160
     aaacgttttg atttggccat gattcagcca ttccttgata aaatgactca agttaaaggc      2220
     gtgttcagcg ggaatgccaa tgtcaaatgg acggcgggac aggctttgcc acaggctaaa      2280
     gtcgtcttgc aaggaaatgg ggttcagctt caccaaatgg ttgagggagc tgcattacct      2340
     gttgattttg aaacgttaac agtgaatgca ggactaacaa atggtaaggc aaatgtggca      2400
     tggctattta agctggcagg caatgggcaa ttaaatggca atgttcaggt ggatgatctg      2460
     gaaggccgcc gcaagctatc tgggaatgtg gatattcgag ctctttcttt aaagctgatt      2520
     aaaccgatct tgggtaaaga cgaaaaagcg gaaggaggct tgaatgccaa cctgcgtttc      2580
     ggtggtaatg taaaaaatcc gctgttgttt ggtcagctta agacggatga ccttcaaatc      2640
     gtaagtcact ggttaccttt tgatatcact caaggccagc tagctatcta ttttgatggt      2700
     gtccgctctg gcttggaggg tgttatcaaa acgcctaaag ggcagctgaa ccttaacggc      2760
     aatgctgact ggcgtaattt gaacgcatgg tatgccaaaa ttgccgcgaa tggtgaaaaa      2820
     ttgcgtgtga cagtgccgcc aatggtgaaa attgatgtta gccctaattt ggtacttgaa      2880
     gctacgcctg atttactgaa acttgatggg aatgtggata ttccgtgggc acgcattacg      2940
     gtgcaggaat taccagagtc tgctgtgggt atttcttctg acgaagtcat gctagataaa      3000
     aatctccagc cgatagaaaa gaaaaaatcg tccattctgg ttaaaagtaa cttaaatatt      3060
     cgcattggtg atgatgtccg tttgaatgca tttggtctga aagctcaact taagggggtc      3120
     ttgaaagtca ttcaggataa acaggggctg gggttgaatg gtcaaattga tattccagat      3180
     ggtcgtttcc atgcctacgg gcaggatttg ctggtacgca agggcacaat tatattttcc      3240
     ggcccgccgg aacagccaat gctgaacatt gaagcgatcc gtaaccccga ctcgacggcg      3300
     aataaggttg tcgctggtgt gaaagttacg ggattggcgg ataaacccaa agttgaaatt      3360
     ttctctgagc cagcaaaatc acagcaggaa gcactgtctt atcttctgcg tggtgaaggt      3420
     ttggagaaga gtggttctga caataaccaa atgacttcca tgctaattgg tttgggcgtt      3480
     tcccaaagtg gtcaattggt tggcaagatt ggtgaaactt ttggtgtttc tgatttagct      3540
     ttagatactc agggtgtggg tgacaaatct caggttgtcg tcagcggcaa gataaccaac      3600
     aacttgcagg tgaaatacgg tgttggtatt tttgattctc tggcgacctt gacattacgc      3660
     tatcgtgtaa tgccaagatt gtatctcgat gcggtatctg gtattgatca ggctttagat      3720
     ctgctctatg agtttgagtt ttaa                                             3744
//

If you have problems or comments...

PBIL Back to PBIL home page