(data stored in ACNUC1104 zone)

EMBL: FN667741.PE338

FN667741.PE338       Location/Qualifiers
FT   CDS_pept        353329..353676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0069"
FT                   /locus_tag="XBJ1_0343"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0343"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79493"
FT                   /db_xref="GOA:D3UYW5"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="InterPro:IPR039126"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYW5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79493.1"
FT                   /translation="MRVIVYGSLRRKQGNHHWMTYAQLLGEHRLEGYEIYDLGHYPAVI
FT                   RGEGTIECEVYRITPSILTELDALKKNYQEYERELIKTPYGSAWIYLYRLPVDGLHRIT
FT                   CGDWIKRHEEE"
     atgcgagtaa ttgtttatgg cagcctgagg cgcaaacaag gtaaccacca ctggatgacc        60
     tatgcccaac ttctaggaga acataggtta gaaggttatg aaatttatga cctgggacat       120
     tatccagcgg tgatccgtgg cgaagggaca attgaatgcg aagtatatcg cattacgcca       180
     tccatcctga cagaactgga tgctttgaaa aagaattatc aggaatacga aagggaattg       240
     attaaaacac cttacggcag tgcatggatc tatttatata gactgcctgt tgatggactg       300
     catcggataa catgtggtga ctggatcaag cgccacgaag aagaataa                    348
//

If you have problems or comments...

PBIL Back to PBIL home page