(data stored in ACNUC1104 zone)

EMBL: FN667741.PE35

FN667741.PE35        Location/Qualifiers
FT   CDS_pept        complement(38853..40310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0008"
FT                   /locus_tag="XBJ1_0035"
FT                   /product="Protein viaA (VWA-domain protein interacting with
FT                   AAA ATPase)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0035"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79190"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR023481"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY12"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79190.1"
FT                   /translation="MLTLTTLDLLLSINEGELIEEIILALLSAPQLTIFFEKYPRFKRA
FT                   LLKDVPAWQQTLQQRIKDTLIPASLAEEFQLYQQLLTANTTKFYQQLPDLADKLEQIKS
FT                   PFTHDAHTLREALSEHTHAGQILFIQHWRTSLILQVTTFHKQLLEQEKEQLLAEIQKRL
FT                   DLSGNLDPIFDENDRAAGRLWDMSKGRLHLTSHNTALFTQYAQFLKQQPELEKLAQLLG
FT                   RSQAAKSIPEDSNTLEPFTQIERIPDTVPEQVSGIQQGDDIQRLLPTELAMLGIEELEY
FT                   EFYRRLVDKKLLIYRLQGDNWQPRNILKPMTHHDHAEQPRGPFIVCVDTSGSMGGFNEH
FT                   CAKAFCLALMRIALADNRHCHIILFSTELIHYDLTSQDGLTQAVHFLGQTFKGGTDLAF
FT                   CLNAIIEKMQESIWKDADAVVISDFIAQRLPDVLIHQIQNLQQRQQHRFHAVSLSHYGK
FT                   PGIMQIFDHIWHFDTGVTSRLLRRWRH"
     atgttaactc tgacaacgct cgatctttta ctctcgatca atgaaggtga actgatcgag        60
     gagatcattt tagcactgtt aagtgcccct caattgacca ttttttttga aaaataccct       120
     aggttcaagc gcgcattatt gaaagatgta cctgcatggc agcaaacact acaacaaaga       180
     ataaaagata cactcattcc tgcctcccta gctgaagaat ttcagttata ccagcaatta       240
     ctaacagcga atacgacaaa attttatcaa caactccctg atctcgcaga taagcttgaa       300
     cagatcaaat ctccttttac ccatgacgcc cacacattgc gagaagcgtt atctgaacac       360
     actcacgcag gacaaatcct gtttattcaa cactggcgta ccagcctgat cctacaagta       420
     acaacctttc acaagcaatt gctggaacag gaaaaagaac aattattggc agagatccaa       480
     aagcgattag atctcagtgg caatctcgat ccgatattcg atgaaaatga tcgcgccgca       540
     gggcgattat gggacatgag caaaggccga cttcacctga cgtcgcacaa taccgcatta       600
     ttcacccaat atgctcaatt tctcaaacag cagcctgaac tggaaaaact ggcacaatta       660
     ctcggccgca gccaagcggc taaatcaatt cctgaagata gcaacaccct tgaaccattc       720
     acccaaatag agcgaatacc agataccgtg ccagagcaag tcagcggtat ccaacaaggt       780
     gacgatatcc agagactttt acccacagaa ctggccatgc tgggaattga agagctggag       840
     tacgaatttt atcggcggtt ggtagataaa aaattactga tctaccggct acaaggggac       900
     aactggcagc caagaaacat attgaagccg atgactcacc atgatcatgc agaacagccc       960
     cgaggaccat ttattgtgtg cgtggatact tccggatcaa tgggcgggtt caatgagcat      1020
     tgtgcaaagg cattttgtct ggcactgatg cgtattgctc tggcagataa tcgtcactgt      1080
     cacatcatat tattttccac agaactcatt cactatgact taacatcaca agatgggcta      1140
     acacaggcgg tacatttttt ggggcaaact ttcaaaggag gaaccgatct ggcattctgc      1200
     ctgaatgcca tcattgagaa aatgcaagaa agtatctgga aagatgccga cgctgttgtt      1260
     atttcagatt tcattgccca gcggttacca gacgttctaa tccatcagat acaaaacctg      1320
     caacaacgcc aacaacaccg cttccatgca gtttccctgt cccattatgg aaagcccggt      1380
     atcatgcaga tattcgatca tatctggcac tttgataccg gagttacaag ccgtttactg      1440
     cgaagatggc gacactga                                                    1458
//

If you have problems or comments...

PBIL Back to PBIL home page