(data stored in ACNUC1104 zone)

EMBL: FN667741.PE361

FN667741.PE361       Location/Qualifiers
FT   CDS_pept        372699..373121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0074"
FT                   /locus_tag="XBJ1_0366"
FT                   /product="YhbC-like protein (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0366"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79516"
FT                   /db_xref="GOA:D3UYY8"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYY8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79516.1"
FT                   /translation="MISAPVEALGFELVGLEFIRARVSTLRVYIDSEEGITVDNCADVS
FT                   HQVSAVLDVEDPISVLYNLEISSPGLERPLFKAEHYQRFMGEEVSLVLRMAMQNRRRWQ
FT                   GIIKVVDGEMITVTVDGKDEVFALSNIQKANLVPHF"
     atgatttcag caccagttga agctttgggg tttgaattag tgggcctgga gtttatccgt        60
     gcacgtgtat caacactgcg ggtctatatc gatagtgagg agggtatcac tgttgataat       120
     tgtgctgatg tgagccacca ggtcagtgca gtactcgatg tcgaagatcc gatctcagtg       180
     ctttataacc tggaaatatc ttcaccagga cttgaacgtc cactgtttaa ggctgaacat       240
     taccagcgtt ttatgggtga agaagttagt ctggttttac gtatggcaat gcagaatcgc       300
     cgtagatggc aaggtattat taaagttgtc gatggtgaaa tgattacggt tacggtggat       360
     ggaaaagacg aagtgttcgc actgagcaac atccagaaag cgaacctggt accccacttt       420
     taa                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page